Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02461
- pan locus tag?: SAUPAN005608000
- symbol: SAOUHSC_02461
- pan gene symbol?: —
- synonym:
- product: MerR family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02461
- symbol: SAOUHSC_02461
- product: MerR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 2284053..2284469
- length: 417
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3919024 NCBI
- RefSeq: YP_500929 NCBI
- BioCyc: G1I0R-2327 BioCyc
- MicrobesOnline: 1290900 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAACTAAAGAAGTCGTAGCGCTCATGAATATATCTCAAGACACTTTAAGATATTAT
GAAAAGGTTGGTGTGATTCCACCAGTTAATCGAGATGAAAATGGATATAGAATATATAAT
GATAGTGATTTAAATTGGATTTATTTAGTGAAAAATTTGCGAAATGCAGGCGTCAGTATT
GAATCGCTTATCGAATTTTGCAGGTTAGCGCAGCTTCCTAAAAATGAAAATATTCAAGCA
CAGCAAAAGCAAATTTTAAATAAGCAACTCGAAGAATTAAATGAAAACTTAAAGACAATT
CATGATGCGAGAGATTTACTACAATATAAAATTGATAATTATGATAATCATATTGCTAAA
ATCAATGCTAGTGATAATTATGATGACAATGTTGAACGTCTTTGGGAGAGAAAGTAA60
120
180
240
300
360
417
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02461
- symbol: SAOUHSC_02461
- description: MerR family transcriptional regulator
- length: 138
- theoretical pI: 5.29007
- theoretical MW: 16340.3
- GRAVY: -0.781159
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 63.8)Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 59.8)and 5 moreRegulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 44.8)Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43.3)Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43.3)Cellular processes Detoxification mercuric resistence transcriptional repressor protein MerD (TIGR02054; HMM-score: 29.7)Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12)
- TheSEED :
- Transcriptional regulator, MerR family
- PFAM: HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 61.5)MerR; MerR family regulatory protein (PF00376; HMM-score: 49.2)and 6 moreMerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 17)no clan defined SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 15.1)HTH (CL0123) HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 15.1)Peptidase_CA (CL0125) Phytochelatin; Phytochelatin synthase (PF05023; HMM-score: 13.3)PDDEXK (CL0236) Dna2; DNA replication factor Dna2 (PF08696; HMM-score: 12.8)no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014504
- TAT(Tat/SPI): 0.000174
- LIPO(Sec/SPII): 0.001416
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSIESLIEFCRLAQLPKNENIQAQQKQILNKQLEELNENLKTIHDARDLLQYKIDNYDNHIAKINASDNYDDNVERLWERK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [3] : SAOUHSC_02460 < SAOUHSC_02461 < S955
⊟Regulation[edit | edit source]
- regulator: CodY* (repression) regulon
CodY* (TF) important in Amino acid metabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)