From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2160 [new locus tag: SAUSA300_RS11905 ]
  • pan locus tag?: SAUPAN005608000
  • symbol: SAUSA300_2160
  • pan gene symbol?:
  • synonym:
  • product: MerR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2160 [new locus tag: SAUSA300_RS11905 ]
  • symbol: SAUSA300_2160
  • product: MerR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2337268..2337684
  • length: 417
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAACTAAAGAAGTCGTAGCGCTCATGAATATATCTCAAGACACTTTAAGATATTAT
    GAAAAGGTTGGTGTGATTCCACCAGTTAATCGAGATGAAAATGGATATAGAATATATAAT
    GATAGTGATTTAAATTGGATTTATTTAGTGAAAAATTTGCGAAATGCAGGCGTCAGTATT
    GAATCGCTTATCGAATTTTGCAGGTTAGCGCAGCTTCCTAAAAATGAAAATATTCAAGCA
    CAGCAAAAGCAAATTTTAAATAAGCAACTCGAAGAATTAAATGAAAACTTAAAGACAATT
    CATGATGTGAGAGATTTACTACAATATAAAATTGATAATTATGATAATCATATTGCTAAA
    ATCAATGCTAGTGATAATTATGATGACAATGTTGAACGTCTTTGGGAGAGAAAGTAA
    60
    120
    180
    240
    300
    360
    417

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2160 [new locus tag: SAUSA300_RS11905 ]
  • symbol: SAUSA300_2160
  • description: MerR family transcriptional regulator
  • length: 138
  • theoretical pI: 5.29007
  • theoretical MW: 16368.4
  • GRAVY: -0.763768

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 65.4)
    Signal transduction Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 61.2)
    and 5 more
    Signal transduction Regulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 45.3)
    Cellular processes Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 44.8)
    Signal transduction Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 44.8)
    Cellular processes Cellular processes Detoxification mercuric resistence transcriptional repressor protein MerD (TIGR02054; HMM-score: 29.6)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12)
  • TheSEED  :
    • Transcriptional regulator, MerR family
  • PFAM:
    HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 61.7)
    MerR; MerR family regulatory protein (PF00376; HMM-score: 51.7)
    and 12 more
    MerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 17.9)
    no clan defined DUF3744; ATP-binding cassette cobalt transporter (PF12558; HMM-score: 14.8)
    GT-B (CL0113) RickCE_N; RickCE N-terminal (PF22189; HMM-score: 14.4)
    no clan defined DUF6397; Family of unknown function (DUF6397) (PF19934; HMM-score: 14.3)
    HTH (CL0123) Rep3_C; Initiator Rep protein, WH2 (PF21205; HMM-score: 14.3)
    Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 14.2)
    HTH (CL0123) HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14)
    Peptidase_CA (CL0125) Phytochelatin; Phytochelatin synthase (PF05023; HMM-score: 13.2)
    no clan defined DUF5320; Family of unknown function (DUF5320) (PF17253; HMM-score: 13)
    GME (CL0197) PAD; Protein-arginine deiminase (PAD) (PF03068; HMM-score: 12.4)
    Tail_Terminator (CL0691) Phage_tail_terminator_7; Bacteriophage Tail Tube Terminator Protein (PF23818; HMM-score: 11.9)
    no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 10.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9363
    • Cytoplasmic Membrane Score: 0.0008
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0623
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014504
    • TAT(Tat/SPI): 0.000174
    • LIPO(Sec/SPII): 0.001416
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSIESLIEFCRLAQLPKNENIQAQQKQILNKQLEELNENLKTIHDVRDLLQYKIDNYDNHIAKINASDNYDDNVERLWERK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: CodY (repression) regulon
    CodY(TF)important in Amino acid metabolism; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]