Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2160 [new locus tag: SAUSA300_RS11905 ]
- pan locus tag?: SAUPAN005608000
- symbol: SAUSA300_2160
- pan gene symbol?: —
- synonym:
- product: MerR family transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2160 [new locus tag: SAUSA300_RS11905 ]
- symbol: SAUSA300_2160
- product: MerR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 2337268..2337684
- length: 417
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914405 NCBI
- RefSeq: YP_494796 NCBI
- BioCyc: see SAUSA300_RS11905
- MicrobesOnline: 1293675 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAACTAAAGAAGTCGTAGCGCTCATGAATATATCTCAAGACACTTTAAGATATTAT
GAAAAGGTTGGTGTGATTCCACCAGTTAATCGAGATGAAAATGGATATAGAATATATAAT
GATAGTGATTTAAATTGGATTTATTTAGTGAAAAATTTGCGAAATGCAGGCGTCAGTATT
GAATCGCTTATCGAATTTTGCAGGTTAGCGCAGCTTCCTAAAAATGAAAATATTCAAGCA
CAGCAAAAGCAAATTTTAAATAAGCAACTCGAAGAATTAAATGAAAACTTAAAGACAATT
CATGATGTGAGAGATTTACTACAATATAAAATTGATAATTATGATAATCATATTGCTAAA
ATCAATGCTAGTGATAATTATGATGACAATGTTGAACGTCTTTGGGAGAGAAAGTAA60
120
180
240
300
360
417
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2160 [new locus tag: SAUSA300_RS11905 ]
- symbol: SAUSA300_2160
- description: MerR family transcriptional regulator
- length: 138
- theoretical pI: 5.29007
- theoretical MW: 16368.4
- GRAVY: -0.763768
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 65.4)Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 61.2)and 5 moreRegulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 45.3)Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 44.8)Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 44.8)Cellular processes Detoxification mercuric resistence transcriptional repressor protein MerD (TIGR02054; HMM-score: 29.6)Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12)
- TheSEED :
- Transcriptional regulator, MerR family
- PFAM: HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 61.7)MerR; MerR family regulatory protein (PF00376; HMM-score: 51.7)and 12 moreMerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 17.9)no clan defined DUF3744; ATP-binding cassette cobalt transporter (PF12558; HMM-score: 14.8)GT-B (CL0113) RickCE_N; RickCE N-terminal (PF22189; HMM-score: 14.4)no clan defined DUF6397; Family of unknown function (DUF6397) (PF19934; HMM-score: 14.3)HTH (CL0123) Rep3_C; Initiator Rep protein, WH2 (PF21205; HMM-score: 14.3)Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 14.2)HTH (CL0123) HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14)Peptidase_CA (CL0125) Phytochelatin; Phytochelatin synthase (PF05023; HMM-score: 13.2)no clan defined DUF5320; Family of unknown function (DUF5320) (PF17253; HMM-score: 13)GME (CL0197) PAD; Protein-arginine deiminase (PAD) (PF03068; HMM-score: 12.4)Tail_Terminator (CL0691) Phage_tail_terminator_7; Bacteriophage Tail Tube Terminator Protein (PF23818; HMM-score: 11.9)no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 10.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9363
- Cytoplasmic Membrane Score: 0.0008
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0623
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014504
- TAT(Tat/SPI): 0.000174
- LIPO(Sec/SPII): 0.001416
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSIESLIEFCRLAQLPKNENIQAQQKQILNKQLEELNENLKTIHDVRDLLQYKIDNYDNHIAKINASDNYDDNVERLWERK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]