From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01941
  • pan locus tag?: SAUPAN004566000
  • symbol: SAOUHSC_01941
  • pan gene symbol?: splB
  • synonym:
  • product: serine protease SplB

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01941
  • symbol: SAOUHSC_01941
  • product: serine protease SplB
  • replicon: chromosome
  • strand: -
  • coordinates: 1845807..1846529
  • length: 723
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAACAAAAACGTAGTCATCAAGAGTTTAGCAGCATTAACAATTTTAACATCTGTAACA
    GGTATTGGAACAACATTGGTTGAGGAAGTACAACAAACTGCCAAAGCAGAAAATAATGTC
    ACAAAAGTTAAAGATACTAATATTTTTCCATATACTGGTGTAGTTGCTTTTAAAAGTGCA
    ACTGGATTTGTAGTTGGAAAGAATACTATTTTAACAAATAAACATGTGTCGAAAAATTAC
    AAAGTGGGCGATCGTATTACTGCACATCCAAATAGTGATAAAGGTAATGGTGGTATTTAT
    TCGATTAAAAAGATTATTAATTATCCAGGTAAAGAAGATGTATCAGTCATTCAAGTTGAA
    GAGCGTGCAATAGAACGTGGACCAAAAGGCTTTAATTTTAATGATAATGTAACGCCATTC
    AAATATGCGGCAGGGGCTAAAGCTGGTGAGCGAATTAAAGTGATTGGTTATCCACACCCA
    TACAAAAATAAATATGTTTTATATGAGTCAACTGGCCCTGTGATGTCAGTAGAAGGTAGC
    AGTATTGTATATTCAGCGCATACTGAAAGCGGAAACTCTGGATCACCTGTATTAAACAGC
    AACAACGAATTAGTTGGTATTCATTTTGCTTCTGATGTAAAAAATGATGATAACAGAAAT
    GCATATGGCGTCTACTTTACACCAGAAATTAAAAAATTCATTGCAGAAAACATAGATAAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    723

Protein[edit | edit source]

Protein Data Bank: 2VID
Protein Data Bank: 4K1S
Protein Data Bank: 4K1T

General[edit | edit source]

  • locus tag: SAOUHSC_01941
  • symbol: SAOUHSC_01941
  • description: serine protease SplB
  • length: 240
  • theoretical pI: 9.68796
  • theoretical MW: 26096.3
  • GRAVY: -0.359167

Function[edit | edit source]

  • reaction:
    EC 3.4.21.-?  ExPASy
  • TIGRFAM:
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides periplasmic serine peptidase DegS (TIGR02038; EC 3.4.21.-; HMM-score: 18.5)
    Signal transduction Regulatory functions Protein interactions periplasmic serine peptidase DegS (TIGR02038; EC 3.4.21.-; HMM-score: 18.5)
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides peptidase Do (TIGR02037; EC 3.4.21.-; HMM-score: 16.7)
    Genetic information processing Protein fate Protein folding and stabilization peptidase Do (TIGR02037; EC 3.4.21.-; HMM-score: 16.7)
  • TheSEED  :
    • serine protease
  • PFAM:
    Peptidase_PA (CL0124) Trypsin; Trypsin (PF00089; HMM-score: 92.5)
    and 6 more
    Trypsin_2; Trypsin-like peptidase domain (PF13365; HMM-score: 64.8)
    Peptidase_S7; Peptidase S7, Flavivirus NS3 serine protease (PF00949; HMM-score: 25.8)
    Peptidase_S46; Peptidase S46 (PF10459; HMM-score: 23.7)
    Peptidase_S32; Equine arteritis virus serine endopeptidase S32 (PF05579; HMM-score: 22)
    Mycop_pep_DUF31; Mycoplasma peptidase (DUF31) (PF01732; HMM-score: 20.3)
    Peptidase_S39; Peptidase S39 (PF02122; HMM-score: 16.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0.0032
    • Extracellular Score: 0.9968
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 36 aa
    • SP(Sec/SPI): 0.947043
    • TAT(Tat/SPI): 0.008645
    • LIPO(Sec/SPII): 0.012863
    • Cleavage Site: CS pos: 36-37. AKA-EN. Pr: 0.8283
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNKNVVIKSLAALTILTSVTGIGTTLVEEVQQTAKAENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: SaeR* (activation) regulon
    SaeR*(TF)important in Virulence; RegPrecise transcription unit according to  [3]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 3.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

S B Reed, C A Wesson, L E Liou, W R Trumble, P M Schlievert, G A Bohach, K W Bayles
Molecular characterization of a novel Staphylococcus aureus serine protease operon.
Infect Immun: 2001, 69(3);1521-7
[PubMed:11179322] [WorldCat.org] [DOI] (P p)
Grzegorz M Popowicz, Grzegorz Dubin, Justyna Stec-Niemczyk, Anna Czarny, Adam Dubin, Jan Potempa, Tad A Holak
Functional and structural characterization of Spl proteases from Staphylococcus aureus.
J Mol Biol: 2006, 358(1);270-9
[PubMed:16516230] [WorldCat.org] [DOI] (P p)
Grzegorz Dubin, Justyna Stec-Niemczyk, Magdalena Kisielewska, Katarzyna Pustelny, Grzegorz M Popowicz, Michal Bista, Tomasz Kantyka, Kevin T Boulware, Henning R Stennicke, Anna Czarna, Mullika Phopaisarn, Patrick S Daugherty, Ida B Thøgersen, Jan J Enghild, Nancy Thornberry, Adam Dubin, Jan Potempa
Enzymatic activity of the Staphylococcus aureus SplB serine protease is induced by substrates containing the sequence Trp-Glu-Leu-Gln.
J Mol Biol: 2008, 379(2);343-56
[PubMed:18448121] [WorldCat.org] [DOI] (I p)