Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01206
- pan locus tag?: SAUPAN003523000
- symbol: SAOUHSC_01206
- pan gene symbol?: —
- synonym:
- product: DNA-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01206
- symbol: SAOUHSC_01206
- product: DNA-binding protein
- replicon: chromosome
- strand: +
- coordinates: 1157575..1157907
- length: 333
- essential: no [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3919472 NCBI
- RefSeq: YP_499743 NCBI
- BioCyc: G1I0R-1130 BioCyc
- MicrobesOnline: 1289657 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGGTCAAAATGATTTAGTTAAAACGTTACGAATGAATTATTTGTTTGATTTTTATCAA
TCCTTATTGACGAATAAACAACGTAATTATTTGGAATTATTTTATCTTGAAGATTATTCT
TTAAGTGAAATCGCAGATACTTTTAATGTGAGTAGACAAGCAGTTTATGATAATATAAGA
AGAACTGGCGATTTAGTTGAAGATTATGAAAAGAAATTGGAATTATACCAGAAATTTGAG
CAACGCCGAGAAATATATGATGAAATGAAACAACATTTAAGTAATCCAGAACAAATACAA
CGTTATATTCAACAATTAGAAGACTTAGAATAG60
120
180
240
300
333
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01206
- symbol: SAOUHSC_01206
- description: DNA-binding protein
- length: 110
- theoretical pI: 4.42952
- theoretical MW: 13581.1
- GRAVY: -0.924545
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 27.6)and 12 moretranscriptional regulator BotR, P-21 (TIGR03209; HMM-score: 20.3)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 18.4)RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 17.9)RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 17.9)RNA polymerase sigma-W factor (TIGR02948; HMM-score: 17.6)RNA polymerase sigma-70 factor, Myxococcales family 1 (TIGR03001; HMM-score: 17.4)RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 17.1)RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.7)RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 15.2)RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 14.3)Energy metabolism Fermentation methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)Energy metabolism Amino acids and amines methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
- TheSEED :
- Signal recognition particle associated protein
- PFAM: HTH (CL0123) UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 142.6)and 17 moreSigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 29.5)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 29.5)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 23.4)HTH_11; HTH domain (PF08279; HMM-score: 22.7)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.7)Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 18.3)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 17.6)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 16.1)HTH_10; HTH DNA binding domain (PF04967; HMM-score: 15.9)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 15.7)no clan defined DUF7769; Domain of unknown function (DUF7769) (PF24964; HMM-score: 15)HTH (CL0123) TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 14.3)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 13.7)DUF1492; Protein of unknown function (DUF1492) (PF07374; HMM-score: 13.1)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.1)HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12.3)P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 10.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9887
- Cytoplasmic Membrane Score: 0.0075
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0037
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000792
- TAT(Tat/SPI): 0.000155
- LIPO(Sec/SPII): 0.00019
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: acpP > rnc > SAOUHSC_01204 > SAOUHSC_01205 > SAOUHSC_01206 > SAOUHSC_01207predicted SigA promoter [4] : SAOUHSC_01196 > SAOUHSC_01197 > SAOUHSC_01198 > SAOUHSC_01199 > S494 > S495 > acpP > S496 > rnc > S497 > SAOUHSC_01204 > SAOUHSC_01205 > SAOUHSC_01206 > SAOUHSC_01207 > S498predicted SigA promoter [4] : S495 > acpP > S496 > rnc > S497 > SAOUHSC_01204 > SAOUHSC_01205 > SAOUHSC_01206 > SAOUHSC_01207 > S498
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 4.0 4.1 4.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
