From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01206
  • pan locus tag?: SAUPAN003523000
  • symbol: SAOUHSC_01206
  • pan gene symbol?: —
  • synonym:
  • product: DNA-binding protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01206
  • symbol: SAOUHSC_01206
  • product: DNA-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1157575..1157907
  • length: 333
  • essential: no [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGGTCAAAATGATTTAGTTAAAACGTTACGAATGAATTATTTGTTTGATTTTTATCAA
    TCCTTATTGACGAATAAACAACGTAATTATTTGGAATTATTTTATCTTGAAGATTATTCT
    TTAAGTGAAATCGCAGATACTTTTAATGTGAGTAGACAAGCAGTTTATGATAATATAAGA
    AGAACTGGCGATTTAGTTGAAGATTATGAAAAGAAATTGGAATTATACCAGAAATTTGAG
    CAACGCCGAGAAATATATGATGAAATGAAACAACATTTAAGTAATCCAGAACAAATACAA
    CGTTATATTCAACAATTAGAAGACTTAGAATAG
    60
    120
    180
    240
    300
    333

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_01206
  • symbol: SAOUHSC_01206
  • description: DNA-binding protein
  • length: 110
  • theoretical pI: 4.42952
  • theoretical MW: 13581.1
  • GRAVY: -0.924545

⊟Function[edit | edit source]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 27.6)
    and 12 more
    transcriptional regulator BotR, P-21 (TIGR03209; HMM-score: 20.3)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 18.4)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 17.9)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 17.9)
    RNA polymerase sigma-W factor (TIGR02948; HMM-score: 17.6)
    RNA polymerase sigma-70 factor, Myxococcales family 1 (TIGR03001; HMM-score: 17.4)
    RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 17.1)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.7)
    RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 15.2)
    RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 14.3)
    Metabolism Energy metabolism Fermentation methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
    Metabolism Energy metabolism Amino acids and amines methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
  • TheSEED  :
    • Signal recognition particle associated protein
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Two cell division clusters relating to chromosome partitioning  Signal recognition particle associated protein
  • PFAM:
    HTH (CL0123) UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 142.6)
    and 22 more
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 29.9)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 28.6)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 24)
    HTH_11; HTH domain (PF08279; HMM-score: 21.8)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 21.7)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 18.4)
    HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 17.8)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 17.4)
    HTH_10; HTH DNA binding domain (PF04967; HMM-score: 15.9)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.2)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 15)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 14.1)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.9)
    no clan defined Syntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 13.7)
    HTH (CL0123) HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.5)
    DUF1492; Protein of unknown function (DUF1492) (PF07374; HMM-score: 13.1)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 12.7)
    GcrA; GcrA cell cycle regulator (PF07750; HMM-score: 12.6)
    HTH_22; HTH domain (PF13309; HMM-score: 12.6)
    TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 11.8)
    P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 11.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000792
    • TAT(Tat/SPI): 0.000155
    • LIPO(Sec/SPII): 0.00019
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. ↑ 4.0 4.1 4.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_01206&oldid=100457"