From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1252 [new locus tag: SACOL_RS06395 ]
  • pan locus tag?: SAUPAN003523000
  • symbol: SACOL1252
  • pan gene symbol?: —
  • synonym:
  • product: DNA-binding protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1252 [new locus tag: SACOL_RS06395 ]
  • symbol: SACOL1252
  • product: DNA-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1261341..1261673
  • length: 333
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGGTCAAAATGATTTAGTTAAAACGTTACGAATGAATTATTTGTTTGATTTTTATCAA
    TCCTTATTGACGAATAAACAACGTAATTATTTGGAATTATTTTATCTTGAAGATTATTCT
    TTAAGTGAAATCGCAGATACTTTTAATGTGAGTAGACAAGCAGTTTATGATAATATAAGA
    AGAACTGGCGATTTAGTTGAAGATTATGAAAAGAAATTGGAATTATACCAGAAATTTGAG
    CAACGCCGAGAAATATATGATGAAATGAAACAACATTTAAGTAATCCAGAACAAATACAA
    CGTTATATTCAACAATTAGAAGACTTAGAATAG
    60
    120
    180
    240
    300
    333

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1252 [new locus tag: SACOL_RS06395 ]
  • symbol: SACOL1252
  • description: DNA-binding protein
  • length: 110
  • theoretical pI: 4.42952
  • theoretical MW: 13581.1
  • GRAVY: -0.924545

⊟Function[edit | edit source]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 27.6)
    and 12 more
    transcriptional regulator BotR, P-21 (TIGR03209; HMM-score: 20.3)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 18.4)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 17.9)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 17.9)
    RNA polymerase sigma-W factor (TIGR02948; HMM-score: 17.6)
    RNA polymerase sigma-70 factor, Myxococcales family 1 (TIGR03001; HMM-score: 17.4)
    RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 17.1)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.7)
    RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 15.2)
    RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 14.3)
    Metabolism Energy metabolism Fermentation methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
    Metabolism Energy metabolism Amino acids and amines methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
  • TheSEED  :
    • Signal recognition particle associated protein
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Two cell division clusters relating to chromosome partitioning  Signal recognition particle associated protein
  • PFAM:
    HTH (CL0123) UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 142.6)
    and 22 more
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 29.9)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 28.6)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 24)
    HTH_11; HTH domain (PF08279; HMM-score: 21.8)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 21.7)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 18.4)
    HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 17.8)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 17.4)
    HTH_10; HTH DNA binding domain (PF04967; HMM-score: 15.9)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.2)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 15)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 14.1)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.9)
    no clan defined Syntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 13.7)
    HTH (CL0123) HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.5)
    DUF1492; Protein of unknown function (DUF1492) (PF07374; HMM-score: 13.1)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 12.7)
    GcrA; GcrA cell cycle regulator (PF07750; HMM-score: 12.6)
    HTH_22; HTH domain (PF13309; HMM-score: 12.6)
    TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 11.8)
    P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 11.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000792
    • TAT(Tat/SPI): 0.000155
    • LIPO(Sec/SPII): 0.00019
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 71 [3]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1252&oldid=101785"