Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS07000 [old locus tag: SACOL1375 ]
- pan locus tag?: SAUPAN003715000
- symbol: SACOL_RS07000
- pan gene symbol?: sosA
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS07000 [old locus tag: SACOL1375 ]
- symbol: SACOL_RS07000
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1379598..1379831
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTTTACAATAAATATAAAAACGTATCAACATATATCATCATATTTTTAGTTTCAAGT
GCAGCCTTTGCAATATTCTTGTTAAGTGCGAACATTAGTGCTCACTCGGAACAAGTGTAC
GAAATGACTGACCATCAAATTAAGAACAATACGATAAATAAAGCATACGAACATAAAGAC
CCTACAAACAATAGCGAACAAAGAGATGGGAAAGTGTTCGCTTTAATAAATTGA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS07000 [old locus tag: SACOL1375 ]
- symbol: SACOL_RS07000
- description: hypothetical protein
- length: 77
- theoretical pI: 7.76467
- theoretical MW: 8861.94
- GRAVY: -0.292208
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL1375
- PFAM: no clan defined PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 15.4)Trigger_C (CL0262) SurA_N_3; SurA-like N-terminal domain (PF13624; HMM-score: 13.2)and 1 moreno clan defined DUF3674; RNA dependent RNA polymerase (PF12426; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 9.87
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.0745
- Cell wall & surface Score: 0.0022
- Extracellular Score: 0.9232
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 36 aa
- SP(Sec/SPI): 0.949776
- TAT(Tat/SPI): 0.004907
- LIPO(Sec/SPII): 0.027163
- Cleavage Site: CS pos: 36-37. AHS-EQ. Pr: 0.6614
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANISAHSEQVYEMTDHQIKNNTINKAYEHKDPTNNSEQRDGKVFALIN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: see SACOL1375
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.