Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1175 [new locus tag: SA_RS06680 ]
- pan locus tag?: SAUPAN003715000
- symbol: SA1175
- pan gene symbol?: sosA
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1175 [new locus tag: SA_RS06680 ]
- symbol: SA1175
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1337897..1338130
- length: 234
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124012 NCBI
- RefSeq: NP_374454 NCBI
- BioCyc: see SA_RS06680
- MicrobesOnline: 103480 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTTTACAATAAATATAAAAACGTATCAACATATATCATCATATTTTTAGTTTCAAGT
GCAGCCTTTGCAATATTCTTGTTAAGTGCGAACGTTAGTGCTCACTCGGAACAAGTGTAC
GAAATGACTGACCATCAAATTAAGAACAATACGATAAATAAAGCATACGAACATAAAGAC
CCTACAAACAATGGCGAACAAAGAGATGGGAAAGTGTTCGCTTTAATAAATTGA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1175 [new locus tag: SA_RS06680 ]
- symbol: SA1175
- description: hypothetical protein
- length: 77
- theoretical pI: 7.76467
- theoretical MW: 8817.88
- GRAVY: -0.290909
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANVSAHSEQVYEMTDHQIKNNTINKAYEHKDPTNNGEQRDGKVFALIN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available