From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001324
  • pan locus tag?: SAUPAN003715000
  • symbol: sosA
  • pan gene symbol?: sosA
  • synonym:
  • product: DNA damage-induced cell division inhibitor SosA

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001324
  • symbol: sosA
  • product: DNA damage-induced cell division inhibitor SosA
  • replicon: chromosome
  • strand: +
  • coordinates: 1331630..1331863
  • length: 234
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTTTTACAATAAATATAAAAACGTATCAACATATATCATCATATTTTTAGTTTCAAGT
    GCAGCCTTTGCAATATTCTTGTTAAGTGCGAACGTTAGTGCTCACTCGGAACAAGTGTAC
    GAAATGACTGACCATCAAATTAAGAACAATACGATAAATAAAGCATACGAACATAAAGAC
    CCTACAAACAATGGCGAACAAAGAGATGGGAAAGTGTTCGCTTTAATAAATTGA
    60
    120
    180
    234

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_001324
  • symbol: SosA
  • description: DNA damage-induced cell division inhibitor SosA
  • length: 77
  • theoretical pI: 7.76467
  • theoretical MW: 8817.88
  • GRAVY: -0.290909

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman
  • PFAM:
    no clan defined PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 15)
    Trigger_C (CL0262) SurA_N_3; SurA-like N-terminal domain (PF13624; HMM-score: 13.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.0242
    • Cell wall & surface Score: 0.0029
    • Extracellular Score: 0.9729
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 36 aa
    • SP(Sec/SPI): 0.965373
    • TAT(Tat/SPI): 0.004489
    • LIPO(Sec/SPII): 0.022725
    • Cleavage Site: CS pos: 36-37. AHS-EQ. Pr: 0.4835
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANVSAHSEQVYEMTDHQIKNNTINKAYEHKDPTNNGEQRDGKVFALIN

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_001324&oldid=106965"