From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS06970 [old locus tag: SACOL1369 ]
  • pan locus tag?: SAUPAN003708000
  • symbol: SACOL_RS06970
  • pan gene symbol?: rpmG2
  • synonym:
  • product: 50S ribosomal protein L33

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS06970 [old locus tag: SACOL1369 ]
  • symbol: SACOL_RS06970
  • product: 50S ribosomal protein L33
  • replicon: chromosome
  • strand: +
  • coordinates: 1375408..1375557
  • length: 150
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (1375408..1375557) NCBI
  • BioCyc: SACOL_RS06970 BioCyc
  • MicrobesOnline: see SACOL1369

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGCGCGTAAACGTAACATTAGCATGCACAGAATGTGGCGATCGTAACTATATCACTACT
    AAAAATAAACGTAATAATCCTGAGCGTATTGAAATGAAAAAATATTGCCCAAGATTAAAC
    AAATATACGTTACATCGTGAAACTAAGTAA
    60
    120
    150

Protein[edit | edit source]

Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SACOL_RS06970 [old locus tag: SACOL1369 ]
  • symbol: SACOL_RS06970
  • description: 50S ribosomal protein L33
  • length: 49
  • theoretical pI: 10.2418
  • theoretical MW: 5931.87
  • GRAVY: -1.26327

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL33 (TIGR01023; HMM-score: 76.3)
  • TheSEED: see SACOL1369
  • PFAM:
    Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 89.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7509
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.2487
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.129447
    • TAT(Tat/SPI): 0.005131
    • LIPO(Sec/SPII): 0.067076
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]