Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2525 [new locus tag: SACOL_RS13225 ]
- pan locus tag?: SAUPAN006150000
- symbol: SACOL2525
- pan gene symbol?: —
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2525 [new locus tag: SACOL_RS13225 ]
- symbol: SACOL2525
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 2586138..2586833
- length: 696
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238189 NCBI
- RefSeq: YP_187319 NCBI
- BioCyc: see SACOL_RS13225
- MicrobesOnline: 913997 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGGATGTTTTAACAATAGAACATTTAACAAAGAAGATAGGCAACAAAACGATTCTCGAA
GATGTATCATTTAAGCTGAAACGCGGACAAATAGTTGGTCTCGTTGGAGCGAATGGTGCA
GGTAAAACAACTTTAATGAAAGTTATATTAGGTTACTCTAGTTTCCAAAGCGGGAATTTT
AATGTTATTAACAGCAAGGACAGCAAAAGCAATATCGGCGCATTGATTGAAAATCCAGGA
ATATATCCTTTTATGTCTGGATATGAAAACTTGAAGTTATTGAATGAATCAAAAAACACT
CAAGATATCGATAAAATTGTCTCACAACTTCATATGGATGAATACATTCATAAAAAAGCT
AAAACGTATTCTCTTGGTATGAAACAAAAATTAGGAATTGCTATAGCATTTTTAAATAAA
CCTCAATTCATTATCTTAGATGAACCAATGAATGGCTTAGATCCAAAAGCTGTGCGAGAT
GTACGTGAATTGATTGTCCAAAAAGCGCAAGAAGGTGTTACTTTCTTAATTTCGAGTCAT
ATTTTAAGTGAATTAGTTAAAATCACAAACTCTATCCTTATTATTAACAAAGGTAAAATT
GTTACAGAAACATCGGAAGAAGAACTTAAACAATTTAAAGATAATGATTTAGAAAATGTA
TTACTAGAAATCATAGAAAGGGAGGACCAAGCATAA60
120
180
240
300
360
420
480
540
600
660
696
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2525 [new locus tag: SACOL_RS13225 ]
- symbol: SACOL2525
- description: ABC transporter ATP-binding protein
- length: 231
- theoretical pI: 6.97895
- theoretical MW: 25803.7
- GRAVY: -0.177922
⊟Function[edit | edit source]
- TIGRFAM: lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 196.9)and 77 moregliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 148.6)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 133.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 130.8)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 130.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 111.4)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 107.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 97.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 95.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 94.2)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 94.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 93.7)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 93.7)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 93.1)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 92.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 89.4)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 88.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 87.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 87.3)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 87.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 85.9)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 85.4)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 85.2)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 85)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 82.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 82.2)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 81.7)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 81.2)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 80.1)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 79)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 79)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 78.9)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 78.7)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 78.5)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 77)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 76.4)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 75.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.8)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 74.5)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 73.3)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 71.9)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 71.5)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 71.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 71)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 71)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 70.7)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 70)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 68.9)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 68.6)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 66)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 66)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 65.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 64.1)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 64.1)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 61.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 60.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 58.4)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 56.5)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 56.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 54.9)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 51.3)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 51.3)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 51.3)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 44.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 44.9)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 42.3)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 40.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 34.3)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 22)Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 18.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 15.5)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 15.2)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 14.1)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 14.1)Cellular processes Pathogenesis type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 11.6)Protein fate Protein and peptide secretion and trafficking type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 11.6)Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 11.6)
- TheSEED :
- ABC transporter ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 98.5)and 17 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 69.8)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 20.9)AAA_14; AAA domain (PF13173; HMM-score: 20.2)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 19)NB-ARC; NB-ARC domain (PF00931; HMM-score: 17.9)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.6)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 16.4)AAA_23; AAA domain (PF13476; HMM-score: 14)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 13.9)AAA_10; AAA-like domain (PF12846; HMM-score: 13.9)ArgK; ArgK protein (PF03308; HMM-score: 13.4)AAA_30; AAA domain (PF13604; HMM-score: 13.3)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.2)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13)Zeta_toxin; Zeta toxin (PF06414; HMM-score: 12.6)AAA_22; AAA domain (PF13401; HMM-score: 12.2)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.038183
- TAT(Tat/SPI): 0.007276
- LIPO(Sec/SPII): 0.002605
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDVLTIEHLTKKIGNKTILEDVSFKLKRGQIVGLVGANGAGKTTLMKVILGYSSFQSGNFNVINSKDSKSNIGALIENPGIYPFMSGYENLKLLNESKNTQDIDKIVSQLHMDEYIHKKAKTYSLGMKQKLGIAIAFLNKPQFIILDEPMNGLDPKAVRDVRELIVQKAQEGVTFLISSHILSELVKITNSILIINKGKIVTETSEEELKQFKDNDLENVLLEIIEREDQA
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
SACOL0593 (fusA) elongation factor G [4] (data from MRSA252) SACOL1734 (gapA2) glyceraldehyde 3-phosphate dehydrogenase 2 [4] (data from MRSA252) SACOL2145 (glmS) glucosamine--fructose-6-phosphate aminotransferase [4] (data from MRSA252) SACOL0222 (ldh1) L-lactate dehydrogenase [4] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [4] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [4] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [4] (data from MRSA252) SACOL1759 universal stress protein [4] (data from MRSA252) SACOL2561 hydroxymethylglutaryl-CoA synthase [4] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ 4.0 4.1 4.2 4.3 4.4 4.5 4.6 4.7 4.8 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)