Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2367 [new locus tag: SACOL_RS12430 ]
- pan locus tag?: SAUPAN005886000
- symbol: SACOL2367
- pan gene symbol?: —
- synonym:
- product: alcohol dehydrogenase, zinc-containing
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2367 [new locus tag: SACOL_RS12430 ]
- symbol: SACOL2367
- product: alcohol dehydrogenase, zinc-containing
- replicon: chromosome
- strand: +
- coordinates: 2427736..2428740
- length: 1005
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238547 NCBI
- RefSeq: YP_187172 NCBI
- BioCyc: see SACOL_RS12430
- MicrobesOnline: 913848 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961GTGATAGAAACATTTAAAGCGTTTGTAATTGATAAAGATGAGAGTGGTAAAGTGACACCA
ACTTTCAAACAATTATCGCCTACTGATTTACCTAAAGGAGATGTGCTGATTAAAGTACAT
TACTCTGGTATAAATTATAAAGATGCTTTAGCGACTCAAGACCATAATGCAGTCGTAAAA
TCGTATCCTATGATTCCAGGAATAGATTTAGCTGGAACAATTGTTGAATCCGAAGCACCA
GGCTTTGAAAAAGGAGAACAAGTAATTGTAACGAGTTATGACCTAGGTGTCAGCCATTAT
GGCGGTTTTAGTGAATATGCGCGTGTAAAATCAGAATGGATTATCAAGCTTCCTGATACT
TTAACATTAGAAGAATCAATGATATATGGCACAGCTGGTTATACTGCCGGTTTAGCAATT
GAAAGACTTGAAAAAGTTGGAATGAATATTGAAGATGGTCCTGTACTCGTTCGCGGTGCT
TCAGGTGGTGTCGGTACTTTAGCAGTACTCATGCTTAATGAACTTGGTTATAAAGTTATC
GCAAGTACAGGTAAACAAGATGTTAGCGATCAATTACTTGAACTTGGTGCCAAAGAAGTT
ATCGATCGACTTCCTGTTGAAGATGATCATAAAAAGCCACTCGCATCATCAACTTGGCAA
GCTTGTGTAGACCCTGTTGGTGGCGAAGGTATTAATTATGTTACAAAGCGTTTAAATCAT
AGTGGGTCAATTGCAGTTATTGGTATGACTGCCGGTAATACTTATACTAATTCTGTATTC
CCTCACATTTTAAGAGGTGTAAACATTTTAGGAATTGACTCGGTATTTACTGCTATGAAA
TTAAGACAGCGCGTTTGGCGTCGTCTCGCAAAAGATTTAATGCCTGAAAATTTACATGAG
ATCAAGCAAGTTATTACATTTGATGAACTTCCAGAACAACTTAACAAAGTAATTAAACAT
GAAAATAAAGGGCGCATTGTTATCGATTTCGGTGTAGATAAATAG60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1005
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2367 [new locus tag: SACOL_RS12430 ]
- symbol: SACOL2367
- description: alcohol dehydrogenase, zinc-containing
- length: 334
- theoretical pI: 5.65303
- theoretical MW: 36569.7
- GRAVY: -0.111377
⊟Function[edit | edit source]
- reaction: EC 1.1.1.1? ExPASyAlcohol dehydrogenase A primary alcohol + NAD+ = an aldehyde + NADH A secondary alcohol + NAD+ = a ketone + NADH
- TIGRFAM: Unknown function Enzymes of unknown specificity putative quinone oxidoreductase, YhdH/YhfP family (TIGR02823; HMM-score: 449.9)and 8 moreUnknown function Enzymes of unknown specificity putative NAD(P)H quinone oxidoreductase, PIG3 family (TIGR02824; HMM-score: 96.4)crotonyl-CoA carboxylase/reductase (TIGR01751; EC 1.3.1.85; HMM-score: 57.9)Energy metabolism Fermentation zinc-binding alcohol dehydrogenase family protein (TIGR02817; HMM-score: 38.6)leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase (TIGR02825; EC 1.3.1.48,1.3.1.74; HMM-score: 36.2)Unknown function Enzymes of unknown specificity NDMA-dependent alcohol dehydrogenase, Rxyl_3153 family (TIGR03989; EC 1.1.99.36; HMM-score: 30.8)Energy metabolism Amino acids and amines L-threonine 3-dehydrogenase (TIGR00692; EC 1.1.1.103; HMM-score: 26.9)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll chlorophyll synthesis pathway protein BchC (TIGR01202; HMM-score: 24.4)6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase (TIGR03201; EC 1.1.1.-; HMM-score: 12.8)
- TheSEED :
- Acryloyl-CoA reductase AcuI/YhdH (EC 1.3.1.84)
and 2 more - PFAM: GroES (CL0296) ADH_N; Alcohol dehydrogenase GroES-like domain (PF08240; HMM-score: 59.3)and 4 moreNADP_Rossmann (CL0063) ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 45.7)GroES (CL0296) ADH_N_2; N-terminal domain of oxidoreductase (PF16884; HMM-score: 14)NADP_Rossmann (CL0063) ADH_zinc_N_2; Zinc-binding dehydrogenase (PF13602; HMM-score: 13.8)ELFV_dehydrog; Glutamate/Leucine/Phenylalanine/Valine dehydrogenase (PF00208; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9439
- Cytoplasmic Membrane Score: 0.0053
- Cell wall & surface Score: 0
- Extracellular Score: 0.0507
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004128
- TAT(Tat/SPI): 0.000424
- LIPO(Sec/SPII): 0.000657
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIETFKAFVIDKDESGKVTPTFKQLSPTDLPKGDVLIKVHYSGINYKDALATQDHNAVVKSYPMIPGIDLAGTIVESEAPGFEKGEQVIVTSYDLGVSHYGGFSEYARVKSEWIIKLPDTLTLEESMIYGTAGYTAGLAIERLEKVGMNIEDGPVLVRGASGGVGTLAVLMLNELGYKVIASTGKQDVSDQLLELGAKEVIDRLPVEDDHKKPLASSTWQACVDPVGGEGINYVTKRLNHSGSIAVIGMTAGNTYTNSVFPHILRGVNILGIDSVFTAMKLRQRVWRRLAKDLMPENLHEIKQVITFDELPEQLNKVIKHENKGRIVIDFGVDK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 130 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 11.69 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
