Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2265 [new locus tag: SACOL_RS11910 ]
- pan locus tag?: SAUPAN005733000
- symbol: mobB
- pan gene symbol?: mobB
- synonym:
- product: molybdopterin-guanine dinucleotide biosynthesis protein B
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2265 [new locus tag: SACOL_RS11910 ]
- symbol: mobB
- product: molybdopterin-guanine dinucleotide biosynthesis protein B
- replicon: chromosome
- strand: -
- coordinates: 2327738..2328223
- length: 486
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237396 NCBI
- RefSeq: YP_187072 NCBI
- BioCyc: see SACOL_RS11910
- MicrobesOnline: 913747 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGATTTTACAAATTGTAGGTTACAAAAAGTCTGGTAAGACAACATTGATGAGGCATATT
GTCTCTTTCTTAAAGTCACATGGTTATACAGTTGCTACTATTAAACATCATGGGCATGGT
AAGGAAGATATTCAATTACAGGATTCAGACGTCGATCACATGAAGCATTTTGAAGCGGGG
GCAGATCAAAGTATTGTACAAGGTTTTCAATATCAGCAAACTGTAACACGTGTAGATAAT
CAAAATCTTACTCAAATTATTGAAAAATCTGTTACAATTGACACCAATATCGTATTAGTT
GAAGGCTTTAAAAATGCTGATTTTGAAAAAGTCGTAGTCTATCGAAATGAAGAAGAGTTG
CAAGTATTACAACAATTGTCGAATGTTTGTTATAGCATTAATGTAAGGGAGCATGAAGAT
TTTACAGCATTTGAGCAATGGTTATTAAATAAAATTAAAAATGATTGTGATACACAATTA
ACATAG60
120
180
240
300
360
420
480
486
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2265 [new locus tag: SACOL_RS11910 ]
- symbol: MobB
- description: molybdopterin-guanine dinucleotide biosynthesis protein B
- length: 161
- theoretical pI: 6.07381
- theoretical MW: 18568.8
- GRAVY: -0.43913
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 133.4)and 9 moreRegulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 16.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 14.4)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 13.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 13.6)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 12.9)Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01807; EC 5.4.99.5; HMM-score: 12.4)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.1)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 11.8)Cellular processes Sporulation and germination stage V sporulation protein B (TIGR02900; HMM-score: 11.4)
- TheSEED :
- Molybdopterin-guanine dinucleotide biosynthesis protein MobB
- PFAM: P-loop_NTPase (CL0023) MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 100.7)and 14 moreATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 20.5)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 19.3)AAA_26; AAA domain (PF13500; HMM-score: 17.9)AAA_14; AAA domain (PF13173; HMM-score: 15.6)DNMK; Deoxynucleotide monophosphate kinase (PF21448; HMM-score: 15.4)CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 15.3)AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 14.6)P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 14)AAA_22; AAA domain (PF13401; HMM-score: 13.9)NTPase_1; NTPase (PF03266; HMM-score: 13.6)AAA_30; AAA domain (PF13604; HMM-score: 13.6)NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 13.3)AAA_18; AAA domain (PF13238; HMM-score: 13.1)DUF2478; Protein of unknown function (DUF2478) (PF10649; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9594
- Cytoplasmic Membrane Score: 0.0398
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0006
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014661
- TAT(Tat/SPI): 0.000551
- LIPO(Sec/SPII): 0.00264
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MILQIVGYKKSGKTTLMRHIVSFLKSHGYTVATIKHHGHGKEDIQLQDSDVDHMKHFEAGADQSIVQGFQYQQTVTRVDNQNLTQIIEKSVTIDTNIVLVEGFKNADFEKVVVYRNEEELQVLQQLSNVCYSINVREHEDFTAFEQWLLNKIKNDCDTQLT
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 61 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)