From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2197 [new locus tag: SACOL_RS11560 ]
  • pan locus tag?: SAUPAN005623000
  • symbol: SACOL2197
  • pan gene symbol?: —
  • synonym:
  • product: surface protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2197 [new locus tag: SACOL_RS11560 ]
  • symbol: SACOL2197
  • product: surface protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2278883..2279308
  • length: 426
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAACTAAAATCATTTGTTACTGCCACTTTAGCATTGGGATTATTATCAACGGTCGGA
    GCTGCATTACCGAGTCACGAAGCATCTGCAGATAGTAATAACGGCTATAAAGAAATGACT
    GTGGATGGTTATCACACTGTTCCTTACACAATTTCAGTAGATGGTATTACTGCATTACAT
    CGAACTTACTTTATCTTCCCAGAAAATAAAAATGTTCTTTATCAAGAAATTGACAGTAAA
    GTAAAAAATGAATTAGCTTCTCAACGTGGTGTTACAACAGAAAAAATTAATAATGCCCAA
    ACAGCAACTTATACGCTTACTTTGAATGATGGTAATAAAAAAGTAGTGAATCTAAAGAAA
    AATGACGACGCTAAAAATTCAATTGATCCAAGTACAATCAAACAGATACAAATTGTAGTT
    AAATAA
    60
    120
    180
    240
    300
    360
    420
    426


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2197 [new locus tag: SACOL_RS11560 ]
  • symbol: SACOL2197
  • description: surface protein
  • length: 141
  • theoretical pI: 9.27199
  • theoretical MW: 15447.4
  • GRAVY: -0.34539

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Truncated cell surface protein map-w
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems Murein hydrolase regulation and cell death  Truncated cell surface protein map-w
  • PFAM:
    no clan defined MAP; MAP domain (PF03642; HMM-score: 120.1)
    and 2 more
    Ubiquitin (CL0072) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 22.3)
    no clan defined YHR052C-B; YHR052C-B (PF23530; HMM-score: 16.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0012
    • Cell wall & surface Score: 0.0131
    • Extracellular Score: 0.9856
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: -0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: HEASADSN
  • SignalP: Signal peptide SP(Sec/SPI) length 30 aa
    • SP(Sec/SPI): 0.99281
    • TAT(Tat/SPI): 0.005319
    • LIPO(Sec/SPII): 0.001605
    • Cleavage Site: CS pos: 30-31. ASA-DS. Pr: 0.9287
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALHRTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Signal peptide containing [1] [2] [3] [4]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [5] [6]   other strains

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  6. ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]