From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1205 [new locus tag: SACOL_RS06170 ]
  • pan locus tag?: SAUPAN003463000
  • symbol: SACOL1205
  • pan gene symbol?: divIVA
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1205 [new locus tag: SACOL_RS06170 ]
  • symbol: SACOL1205
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1210058..1210675
  • length: 618
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGCCTTTTACACCAAATGAAATTAAGAATAAAGAGTTTTCACGTGTAAAGAATGGTTTA
    GAACCTACTGAAGTTGCTAATTTTTTGGAGCAACTAAGCACTGAAATTGAACGTCTTAAA
    GAAGATAAAAAACAACTTGAAAAAGTAATCGAAGAGAGAGATACTAATATTAAGTCTTAT
    CAAGACGTGCATCAATCTGTAAGTGATGCTTTGATACAAGCTCAAAAAGCTGGTGAAGAA
    ACTAAGCAAGCTGCAGAGAAACAAGCTGAAGCGATTATAGCTAAGGCAGAAGCGCAAGCT
    AATCAAATGGTTGGTGACGCGGTAGAAAAAGCACGCCGTTTAGCATTCCAGACTGAAGAT
    ATGAAACGTCAATCAAAAGTATTTAGATCGCGTTTCCGTATGTTAGTTGAAGCGCAATTA
    GACTTATTAAAAAACGAAGATTGGGATTACTTGTTGAATTATGATTTAGACGCTGAACAA
    GTGACGCTTGAAAATATTCATCATTTGCATGAAAATGATTTAAAGCCAGATGAAGTTGCA
    GCAAATGCACAAAATAATGCATCAAATACACCAGACAATAATCAACAATCCAATGATTCA
    GAAACAACTAAGAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    618


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1205 [new locus tag: SACOL_RS06170 ]
  • symbol: SACOL1205
  • description: hypothetical protein
  • length: 205
  • theoretical pI: 4.63557
  • theoretical MW: 23513.8
  • GRAVY: -1.00683

⊟Function[edit | edit source]

  • TIGRFAM:
    DivIVA domain (TIGR03544; HMM-score: 29.9)
    and 5 more
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 12.7)
    Cellular processes Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 10.8)
    Metabolism Energy metabolism ATP-proton motive force interconversion ATP synthase F0, B subunit (TIGR01144; EC 3.6.3.14; HMM-score: 5.6)
    ATP synthase archaeal, H subunit (TIGR02926; EC 3.6.3.14; HMM-score: 4.9)
    SH3 domain protein (TIGR04211; HMM-score: 4.8)
  • TheSEED  :
    • Cell division initiation protein DivIVA
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Bacterial Cytoskeleton  Cell division initiation protein DivIVA
  • PFAM:
    no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 122.3)
    and 19 more
    ATP_synthase (CL0255) ATP-synt_B; ATP synthase B/B' CF(0) (PF00430; HMM-score: 19.7)
    no clan defined ISG65-75; Invariant surface glycoprotein (PF11727; HMM-score: 14.9)
    HTH (CL0123) ORC1_wHTH; Origin recognition complex subunit 1 C-terminal winged HTH domain (PF21312; HMM-score: 14.1)
    no clan defined FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 14)
    DUF6507; Family of unknown function (DUF6507) (PF20117; HMM-score: 13.1)
    Leu_zip; Leucine zipper (PF15294; HMM-score: 12.9)
    DUF3829_2nd; DUF3829-like, C-terminal domain (PF22219; HMM-score: 12.8)
    DUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 12.7)
    P-loop_NTPase (CL0023) UvrD_C; UvrD-like helicase C-terminal domain (PF13361; HMM-score: 12.6)
    NADP_Rossmann (CL0063) NAD_binding_5; Myo-inositol-1-phosphate synthase (PF07994; HMM-score: 12)
    ATP_synthase (CL0255) HrpE; HrpE/YscL/FliH and V-type ATPase subunit E (PF06188; HMM-score: 11.1)
    no clan defined YtxH; YtxH-like protein (PF12732; HMM-score: 10.8)
    ZYG-11_interact; Interactor of ZYG-11 (PF05884; HMM-score: 9.8)
    Dak2; DAK2 domain (PF02734; HMM-score: 9.2)
    CENP-F_leu_zip; Leucine-rich repeats of kinetochore protein Cenp-F/LEK1 (PF10473; HMM-score: 9.2)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 9.1)
    no clan defined SseC; Secretion system effector C (SseC) like family (PF04888; HMM-score: 8.7)
    LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 7.8)
    S5 (CL0329) EFL1; Elongation factor-like GTPase 1-like domain (PF25118; HMM-score: 7.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9864
    • Cytoplasmic Membrane Score: 0.0066
    • Cell wall & surface Score: 0.0009
    • Extracellular Score: 0.006
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002206
    • TAT(Tat/SPI): 0.000287
    • LIPO(Sec/SPII): 0.000323
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MPFTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSYQDVHQSVSDALIQAQKAGEETKQAAEKQAEAIIAKAEAQANQMVGDAVEKARRLAFQTEDMKRQSKVFRSRFRMLVEAQLDLLKNEDWDYLLNYDLDAEQVTLENIHHLHENDLKPDEVAANAQNNASNTPDNNQQSNDSETTKK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 2416 [4]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 23.33 h [5]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]