Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1205 [new locus tag: SACOL_RS06170 ]
- pan locus tag?: SAUPAN003463000
- symbol: SACOL1205
- pan gene symbol?: divIVA
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1205 [new locus tag: SACOL_RS06170 ]
- symbol: SACOL1205
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1210058..1210675
- length: 618
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237866 NCBI
- RefSeq: YP_186068 NCBI
- BioCyc: see SACOL_RS06170
- MicrobesOnline: 912673 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGCCTTTTACACCAAATGAAATTAAGAATAAAGAGTTTTCACGTGTAAAGAATGGTTTA
GAACCTACTGAAGTTGCTAATTTTTTGGAGCAACTAAGCACTGAAATTGAACGTCTTAAA
GAAGATAAAAAACAACTTGAAAAAGTAATCGAAGAGAGAGATACTAATATTAAGTCTTAT
CAAGACGTGCATCAATCTGTAAGTGATGCTTTGATACAAGCTCAAAAAGCTGGTGAAGAA
ACTAAGCAAGCTGCAGAGAAACAAGCTGAAGCGATTATAGCTAAGGCAGAAGCGCAAGCT
AATCAAATGGTTGGTGACGCGGTAGAAAAAGCACGCCGTTTAGCATTCCAGACTGAAGAT
ATGAAACGTCAATCAAAAGTATTTAGATCGCGTTTCCGTATGTTAGTTGAAGCGCAATTA
GACTTATTAAAAAACGAAGATTGGGATTACTTGTTGAATTATGATTTAGACGCTGAACAA
GTGACGCTTGAAAATATTCATCATTTGCATGAAAATGATTTAAAGCCAGATGAAGTTGCA
GCAAATGCACAAAATAATGCATCAAATACACCAGACAATAATCAACAATCCAATGATTCA
GAAACAACTAAGAAGTAA60
120
180
240
300
360
420
480
540
600
618
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1205 [new locus tag: SACOL_RS06170 ]
- symbol: SACOL1205
- description: hypothetical protein
- length: 205
- theoretical pI: 4.63557
- theoretical MW: 23513.8
- GRAVY: -1.00683
⊟Function[edit | edit source]
- TIGRFAM: DivIVA domain (TIGR03544; HMM-score: 29.9)and 5 moreDNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 12.7)Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 10.8)Energy metabolism ATP-proton motive force interconversion ATP synthase F0, B subunit (TIGR01144; EC 3.6.3.14; HMM-score: 5.6)ATP synthase archaeal, H subunit (TIGR02926; EC 3.6.3.14; HMM-score: 4.9)SH3 domain protein (TIGR04211; HMM-score: 4.8)
- TheSEED :
- Cell division initiation protein DivIVA
- PFAM: no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 122.3)and 19 moreATP_synthase (CL0255) ATP-synt_B; ATP synthase B/B' CF(0) (PF00430; HMM-score: 19.7)no clan defined ISG65-75; Invariant surface glycoprotein (PF11727; HMM-score: 14.9)HTH (CL0123) ORC1_wHTH; Origin recognition complex subunit 1 C-terminal winged HTH domain (PF21312; HMM-score: 14.1)no clan defined FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 14)DUF6507; Family of unknown function (DUF6507) (PF20117; HMM-score: 13.1)Leu_zip; Leucine zipper (PF15294; HMM-score: 12.9)DUF3829_2nd; DUF3829-like, C-terminal domain (PF22219; HMM-score: 12.8)DUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 12.7)P-loop_NTPase (CL0023) UvrD_C; UvrD-like helicase C-terminal domain (PF13361; HMM-score: 12.6)NADP_Rossmann (CL0063) NAD_binding_5; Myo-inositol-1-phosphate synthase (PF07994; HMM-score: 12)ATP_synthase (CL0255) HrpE; HrpE/YscL/FliH and V-type ATPase subunit E (PF06188; HMM-score: 11.1)no clan defined YtxH; YtxH-like protein (PF12732; HMM-score: 10.8)ZYG-11_interact; Interactor of ZYG-11 (PF05884; HMM-score: 9.8)Dak2; DAK2 domain (PF02734; HMM-score: 9.2)CENP-F_leu_zip; Leucine-rich repeats of kinetochore protein Cenp-F/LEK1 (PF10473; HMM-score: 9.2)GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 9.1)no clan defined SseC; Secretion system effector C (SseC) like family (PF04888; HMM-score: 8.7)LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 7.8)S5 (CL0329) EFL1; Elongation factor-like GTPase 1-like domain (PF25118; HMM-score: 7.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9864
- Cytoplasmic Membrane Score: 0.0066
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.006
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002206
- TAT(Tat/SPI): 0.000287
- LIPO(Sec/SPII): 0.000323
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPFTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSYQDVHQSVSDALIQAQKAGEETKQAAEKQAEAIIAKAEAQANQMVGDAVEKARRLAFQTEDMKRQSKVFRSRFRMLVEAQLDLLKNEDWDYLLNYDLDAEQVTLENIHHLHENDLKPDEVAANAQNNASNTPDNNQQSNDSETTKK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 2416 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 23.33 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
