Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1158 [new locus tag: SACOL_RS05915 ]
- pan locus tag?: SAUPAN003387000
- symbol: sdhC
- pan gene symbol?: sdhC
- synonym:
- product: succinate dehydrogenase, cytochrome b558 subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1158 [new locus tag: SACOL_RS05915 ]
- symbol: sdhC
- product: succinate dehydrogenase, cytochrome b558 subunit
- replicon: chromosome
- strand: +
- coordinates: 1168331..1168945
- length: 615
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238335 NCBI
- RefSeq: YP_186021 NCBI
- BioCyc: see SACOL_RS05915
- MicrobesOnline: 912625 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601TTGGCTCAATCAAAAAATGAATTTTATCTAAGACGTATTCACTCGTTATTAGGTATTATC
CCAATAGGTGCATTTTTGGTCGTTCATTTATTAGTGAATCACCAAGCAACACAAGGTGCT
GAAGCGTTTAATAAGGCATCTAACTTTATGGAATCATTACCATTTCTAATTATTGTAGAA
TTTTTATTTATATACATTCCGTTGTTATATCACGGTTTGTTTGGTATACACATTGCATTT
ACAGCAAAAGAAAATGTTGGACATTACTCGATTTTTAGAAACTGGATGTTCTTCTTCCAA
AGAGTGAGTGGTATCTTAACATTTATCTTTATTGGTATCCATTTATGGCAAACACGTTTA
CAAAAAGCATTTTACGGCAAAGAAGTGAATTACGATTTAATGCACGAAACATTGCAACAT
CCTGGATGGGCAATATTTTATATTATTTGTATTATTGCTGTTGTGTTCCACTTTGCAAAT
GGCTTATGGTCATTCTTAGTTACTTGGGGTGGACTTCAATCTCCAAAATCACAACGAGTA
TTTACATGGGTTTCATTAATCGTATTTTTAGTTATTTCGTATATTGGTGTTACTGCAATT
ATTGCCTTTATGTAA60
120
180
240
300
360
420
480
540
600
615
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1158 [new locus tag: SACOL_RS05915 ]
- symbol: SdhC
- description: succinate dehydrogenase, cytochrome b558 subunit
- length: 204
- theoretical pI: 9.57454
- theoretical MW: 23598.8
- GRAVY: 0.720588
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism TCA cycle succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family (TIGR02046; HMM-score: 143.1)and 3 moreEnergy metabolism TCA cycle succinate dehydrogenase, cytochrome b556 subunit (TIGR02970; HMM-score: 53.4)Energy metabolism TCA cycle succinate dehydrogenase, hydrophobic membrane anchor protein (TIGR02968; HMM-score: 20.4)Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 10.9)
- TheSEED :
- Succinate dehydrogenase cytochrome b558 subunit
- PFAM: FumRed-TM (CL0335) Sdh_cyt; Succinate dehydrogenase/Fumarate reductase transmembrane subunit (PF01127; HMM-score: 47.9)and 3 moreno clan defined DUF2177; Predicted membrane protein (DUF2177) (PF09945; HMM-score: 16.6)FumRed-TM (CL0335) MCP1_TM; MDM10-complementing protein 1, transmembrane domain (PF07950; HMM-score: 10.4)no clan defined DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 8.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 5
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 1
- Cell wall & surface Score: 0
- Extracellular Score: 0
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.184518
- TAT(Tat/SPI): 0.037838
- LIPO(Sec/SPII): 0.006279
- predicted transmembrane helices (TMHMM): 5
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAQSKNEFYLRRIHSLLGIIPIGAFLVVHLLVNHQATQGAEAFNKASNFMESLPFLIIVEFLFIYIPLLYHGLFGIHIAFTAKENVGHYSIFRNWMFFFQRVSGILTFIFIGIHLWQTRLQKAFYGKEVNYDLMHETLQHPGWAIFYIICIIAVVFHFANGLWSFLVTWGGLQSPKSQRVFTWVSLIVFLVISYIGVTAIIAFM
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Integral membrane [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: sdhC > sdhA > sdhB
⊟Regulation[edit | edit source]
- regulator: CcpA regulon
CcpA (TF) important in Carbon catabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e)