From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0994 [new locus tag: SA_RS05635 ]
  • pan locus tag?: SAUPAN003387000
  • symbol: sdhC
  • pan gene symbol?: sdhC
  • synonym:
  • product: succinate dehydrogenase cytochrome b-558

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0994 [new locus tag: SA_RS05635 ]
  • symbol: sdhC
  • product: succinate dehydrogenase cytochrome b-558
  • replicon: chromosome
  • strand: +
  • coordinates: 1127360..1127974
  • length: 615
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    TTGGCTCAATCAAAAAATGAATTTTATCTAAGACGTATTCACTCGTTATTAGGTATTATC
    CCAATAGGTGCATTTTTGGTCGTTCATTTATTAGTGAATCACCAAGCAACACAAGGTGCT
    GAAGCGTTTAATAAGGCATCTAACTTTATGGAATCATTACCATTTCTAATTATTGTAGAA
    TTTTTATTTATATACATTCCGTTGTTATATCACGGTTTGTTTGGTATACACATTGCATTT
    ACAGCAAAAGAAAATGTTGGACATTACTCGATTTTTAGAAACTGGATGTTCTTCTTCCAA
    AGAGTGAGTGGTATCTTAACATTTATCTTTATTGGTATCCATTTATGGCAAACACGTTTA
    CAAAAAGCATTTTACGGCAAAGAAGTGAATTACGATTTAATGCACGAAACATTGCAACAT
    CCTGGATGGGCAATATTTTATATTATTTGTATTATTGCTGTTGTGTTCCACTTTGCAAAT
    GGCTTATGGTCATTCTTAGTTACTTGGGGTGGACTTCAATCTCCAAAATCACAACGAGTA
    TTTACATGGGTTTCATTAATCGTATTTTTAGTTATTTCGTATATTGGTGTTACTGCAATT
    ATTGCCTTTATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    615

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0994 [new locus tag: SA_RS05635 ]
  • symbol: SdhC
  • description: succinate dehydrogenase cytochrome b-558
  • length: 204
  • theoretical pI: 9.57454
  • theoretical MW: 23598.8
  • GRAVY: 0.720588

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism TCA cycle succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family (TIGR02046; HMM-score: 143.1)
    and 3 more
    Metabolism Energy metabolism TCA cycle succinate dehydrogenase, cytochrome b556 subunit (TIGR02970; HMM-score: 53.4)
    Metabolism Energy metabolism TCA cycle succinate dehydrogenase, hydrophobic membrane anchor protein (TIGR02968; HMM-score: 20.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 10.9)
  • TheSEED  :
    • Succinate dehydrogenase cytochrome b558 subunit
    Respiration Electron donating reactions Succinate dehydrogenase  Succinate dehydrogenase cytochrome b558 subunit
  • PFAM:
    FumRed-TM (CL0335) Sdh_cyt; Succinate dehydrogenase/Fumarate reductase transmembrane subunit (PF01127; HMM-score: 47.9)
    and 3 more
    no clan defined DUF2177; Predicted membrane protein (DUF2177) (PF09945; HMM-score: 16.6)
    FumRed-TM (CL0335) MCP1_TM; MDM10-complementing protein 1, transmembrane domain (PF07950; HMM-score: 10.4)
    no clan defined DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 8.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 1
    • Cell wall & surface Score: 0
    • Extracellular Score: 0
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.184518
    • TAT(Tat/SPI): 0.037838
    • LIPO(Sec/SPII): 0.006279
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAQSKNEFYLRRIHSLLGIIPIGAFLVVHLLVNHQATQGAEAFNKASNFMESLPFLIIVEFLFIYIPLLYHGLFGIHIAFTAKENVGHYSIFRNWMFFFQRVSGILTFIFIGIHLWQTRLQKAFYGKEVNYDLMHETLQHPGWAIFYIICIIAVVFHFANGLWSFLVTWGGLQSPKSQRVFTWVSLIVFLVISYIGVTAIIAFM

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: CcpA regulon
    CcpA(TF)important in Carbon catabolism; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]