Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0730 [new locus tag: SACOL_RS03750 ]
- pan locus tag?: SAUPAN002553000
- symbol: SACOL0730
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0730 [new locus tag: SACOL_RS03750 ]
- symbol: SACOL0730
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 754818..755462
- length: 645
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236058 NCBI
- RefSeq: YP_185610 NCBI
- BioCyc: see SACOL_RS03750
- MicrobesOnline: 912206 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601GTGAAAGTAAAGTATATAGATAAACGTCACTGGCGTCGCCTAATTGATAGGGAATACACA
GAGGTAAAAGTTAATAATAATAGGTTTAAGGGTATTATAGGCTTAGTCACGATGAAAAAG
GTTCGTGATCCTTTAGAGGTGACGGTAGTTGGACAAAATATCATTGTCGCAGATGACAAT
TATAAATGGTTGCAAATACTACCTGAAAAGAAACGTTATAGTATAACTGTAATGTTTGAT
AATAAAGGCAATCCATTAGAATATTATTTTGATATAAATATCAAAAATATAACGCAAAAA
GGTAATGCGCGTACAGTAGATTTATGTTTAGATGTTTTAGCATTACCAAGTGGTGAATAT
GAGTTGGTAGATGAAGATGATTTAATGTTTGCATTAGAAAGTGAGCAAATTACAAAAAAG
CAATTTCATGAAGCATATATGATTGCACATCAAATTATGGCAGAGTTAGAAAATGATTTT
AAAGGATTCCAAAAGAAAATCATGTACTGCTTTAATAAAATTAATGCAAAGGCTCAAAAA
AATCATCAAAAGCCACAAAATAAAACTAATATTGAAAAAAGCAAACAAATAAAGCCTAAG
CAATATAATCAAACTAAAAATCACCAACAACAAAAGAAAAACTAA60
120
180
240
300
360
420
480
540
600
645
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0730 [new locus tag: SACOL_RS03750 ]
- symbol: SACOL0730
- description: hypothetical protein
- length: 214
- theoretical pI: 9.96721
- theoretical MW: 25416.2
- GRAVY: -0.827103
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01107967: hypothetical protein
- PFAM: no clan defined DUF402; Protein of unknown function (DUF402) (PF04167; HMM-score: 59.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8357
- Cytoplasmic Membrane Score: 0.0177
- Cell wall & surface Score: 0.0028
- Extracellular Score: 0.1438
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003042
- TAT(Tat/SPI): 0.000171
- LIPO(Sec/SPII): 0.000447
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKVKYIDKRHWRRLIDREYTEVKVNNNRFKGIIGLVTMKKVRDPLEVTVVGQNIIVADDNYKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNARTVDLCLDVLALPSGEYELVDEDDLMFALESEQITKKQFHEAYMIAHQIMAELENDFKGFQKKIMYCFNKINAKAQKNHQKPQNKTNIEKSKQIKPKQYNQTKNHQQQKKN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 45 [3]
- interaction partners:
SACOL1513 (hup) DNA-binding protein HU [4] (data from MRSA252) SACOL1727 (infC) translation initiation factor IF-3 [4] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [4] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [4] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [4] (data from MRSA252) SACOL2232 (rplP) 50S ribosomal protein L16 [4] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [4] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [4] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [4] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [4] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [4] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [4] (data from MRSA252) SACOL0303 5'-nucleotidase [4] (data from MRSA252) SACOL1753 universal stress protein [4] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 4.00 4.01 4.02 4.03 4.04 4.05 4.06 4.07 4.08 4.09 4.10 4.11 4.12 4.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)