Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0565 [new locus tag: SACOL_RS02935 ]
- pan locus tag?: SAUPAN002284000
- symbol: SACOL0565
- pan gene symbol?: pdxT
- synonym:
- product: glutamine amidotransferase subunit PdxT
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0565 [new locus tag: SACOL_RS02935 ]
- symbol: SACOL0565
- product: glutamine amidotransferase subunit PdxT
- replicon: chromosome
- strand: +
- coordinates: 585856..586416
- length: 561
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237615 NCBI
- RefSeq: YP_185453 NCBI
- BioCyc: see SACOL_RS02935
- MicrobesOnline: 912046 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAAATAGGTGTATTAGCATTACAAGGTGCAGTACGTGAACATATTAGACATATTGAA
TTAAGTGGTCATGAAGGTATTGCAGTTAAAAAAGTTGAACAATTAGAAGAAATCGAGGGC
TTAATATTACCTGGTGGCGAGTCTACAACGTTACGTCGATTAATGAATTTATATGGATTT
AAAGAGGCTTTACAAAATTCAACTTTACCTATGTTTGGTACATGCGCAGGATTAATAGTT
CTAGCGCAAGATATAGTTGGTGAAGAAGGATACCTTAACAAGTTGAATATTACTGTACAA
CGAAACTCATTCGGTAGACAAGTTGACAGCTTTGAAACAGAATTAGATATTAAAGGTATC
GCTACAGATATTGAAGGTGTCTTTATAAGAGCCCCACATATTGAAAAAGTAGGTCAAGGC
GTAGATATCCTATGTAAGGTTAATGAGAAAATTGTAGCTGTTCAGCAAGGTAAATATTTA
GGCGTATCATTCCATCCTGAATTAACAGATGACTATAGAGTAACTGATTACTTTATTAAT
CATATTGTAAAAAAAGCATAG60
120
180
240
300
360
420
480
540
561
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0565 [new locus tag: SACOL_RS02935 ]
- symbol: SACOL0565
- description: glutamine amidotransferase subunit PdxT
- length: 186
- theoretical pI: 5.94492
- theoretical MW: 20629.7
- GRAVY: -0.0225806
⊟Function[edit | edit source]
- reaction: EC 3.5.1.2? ExPASyGlutaminase L-glutamine + H2O = L-glutamate + NH3EC 4.3.3.6? ExPASyPyridoxal 5'-phosphate synthase (glutamine hydrolyzing) D-ribose 5-phosphate + D-glyceraldehyde 3-phosphate + L-glutamine = pyridoxal 5'-phosphate + L-glutamate + 3 H2O + phosphate
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Pyridoxine pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 (TIGR03800; EC 2.6.-.-; HMM-score: 269.3)and 2 morePurines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis GMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 27.9)Amino acid biosynthesis Histidine family imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 25.3)
- TheSEED :
- Pyridoxine biosynthesis glutamine amidotransferase, glutaminase subunit (EC 2.4.2.-)
- PFAM: Glutaminase_I (CL0014) SNO; SNO glutamine amidotransferase family (PF01174; HMM-score: 233.1)and 4 moreGATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 26.7)GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 26.2)Peptidase_S51; Peptidase family S51 (PF03575; HMM-score: 16)DJ-1_PfpI; DJ-1/PfpI family (PF01965; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9945
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0052
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006142
- TAT(Tat/SPI): 0.000148
- LIPO(Sec/SPII): 0.000538
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPGGESTTLRRLMNLYGFKEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSFGRQVDSFETELDIKGIATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVSFHPELTDDYRVTDYFINHIVKKA
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 670 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 50.91 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
