From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0508 [new locus tag: SACOL_RS02565 ]
  • pan locus tag?: SAUPAN002180000
  • symbol: SACOL0508
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0508 [new locus tag: SACOL_RS02565 ]
  • symbol: SACOL0508
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 509124..509393
  • length: 270
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCAAAACGTTCCAAATCACAACGTTTATCAAGTTTACTAAATGTCGCAGGTTTCATA
    GTCGACGGCTACAATGGCTATAAATATCATGCTAAAAATAAAAAATTAGTATATCTTTCA
    TTAGGTTTAAGCACTGTAGGAACCGTGTTAGACTTTTACATTTCAATTAAGTCACCACGT
    AAGTTCAAAAAAGCAGTGGCAGTTGTTACTTTAATAACAAACGGTGCTAGATTATTTACA
    AGCATTCGCAAAGTAAAACATGAATACTAA
    60
    120
    180
    240
    270


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL0508 [new locus tag: SACOL_RS02565 ]
  • symbol: SACOL0508
  • description: hypothetical protein
  • length: 89
  • theoretical pI: 11.0199
  • theoretical MW: 9998.75
  • GRAVY: -0.0449438

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Uncharacterized protein SERP0102
  • PFAM:
    no clan defined ATP-synt_Z; Putative AtpZ or ATP-synthase-associated (PF16594; HMM-score: 11.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0044
    • Cytoplasmic Membrane Score: 0.7149
    • Cell wall & surface Score: 0.006
    • Extracellular Score: 0.2747
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021496
    • TAT(Tat/SPI): 0.002282
    • LIPO(Sec/SPII): 0.00885
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIKSPRKFKKAVAVVTLITNGARLFTSIRKVKHEY

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Integral membrane [1] [2]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]