Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000398 [new locus tag: EGJ38_RS01985 ]
- pan locus tag?: SAUPAN002180000
- symbol: EGJ38_000398
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000398 [new locus tag: EGJ38_RS01985 ]
- symbol: EGJ38_000398
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 427932..428201
- length: 270
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422399 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCAAAACGTTCCAAATCACAACGTTTATCAAGTTTACTAAATGTCGCAGGTTTCATA
GTCGACGGCTACAATGGCTATAAATATCATGCTAAAAATAAAAAATTAGTATATCTTTCA
TTAGGTTTAAGCACTGTAGGAACCGTGTTAGACTTTTACATTTCAATTAAGTCACCACGT
AAGTTCAAAAAAGCAGTGGCAGTTGTTACTTTAATAACAAACGGTGCTAGATTATTTACA
AGCATTCGCAAAGTAAAGCATGAATACTAA60
120
180
240
270
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000398 [new locus tag: EGJ38_RS01985 ]
- symbol: EGJ38_000398
- description: hypothetical protein
- length: 89
- theoretical pI: 11.0199
- theoretical MW: 9998.75
- GRAVY: -0.0449438
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined ATP-synt_Z; Putative AtpZ or ATP-synthase-associated (PF16594; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0044
- Cytoplasmic Membrane Score: 0.7149
- Cell wall & surface Score: 0.006
- Extracellular Score: 0.2747
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.021496
- TAT(Tat/SPI): 0.002282
- LIPO(Sec/SPII): 0.00885
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422399 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIKSPRKFKKAVAVVTLITNGARLFTSIRKVKHEY
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]