Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0424 [new locus tag: SA_RS02415 ]
- pan locus tag?: SAUPAN002180000
- symbol: SA0424
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0424 [new locus tag: SA_RS02415 ]
- symbol: SA0424
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 486130..486408
- length: 279
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123209 NCBI
- RefSeq: NP_373676 NCBI
- BioCyc: see SA_RS02415
- MicrobesOnline: 102702 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATTATTATTATGGCAAAACGTTCCAAATCACAACGTTTATCAAGTTTACTAAATGTCGCA
GGTTTCATAGTCGACGGCTACAATGGCTATAAATATCATGCTAAAAATAAAAAATTAGTA
TATCTTTCATTAGGTTTAAGCACTGTAGGAACCGTGTTAGACTTTTACATTTCAATTAAG
TCACCACGTAAGTTCAAAAAAGCAGTGGCAGTTGTTACTTTAATAACAAACGGTGCTAGA
TTATTTACAAGCATTCGCAAAGTAAAGCATGAATACTAA60
120
180
240
279
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0424 [new locus tag: SA_RS02415 ]
- symbol: SA0424
- description: hypothetical protein
- length: 92
- theoretical pI: 11.0199
- theoretical MW: 10356.3
- GRAVY: 0.075
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0042
- Cytoplasmic Membrane Score: 0.7311
- Cell wall & surface Score: 0.0047
- Extracellular Score: 0.26
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013849
- TAT(Tat/SPI): 0.003218
- LIPO(Sec/SPII): 0.009073
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIIMAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIKSPRKFKKAVAVVTLITNGARLFTSIRKVKHEY
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]