Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1967 [new locus tag: SA_RS11285 ]
- pan locus tag?: SAUPAN005508000
- symbol: SA1967
- pan gene symbol?: dacA
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1967 [new locus tag: SA_RS11285 ]
- symbol: SA1967
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2228184..2228993
- length: 810
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124873 NCBI
- RefSeq: NP_375277 NCBI
- BioCyc: see SA_RS11285
- MicrobesOnline: 104303 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781ATGGATTTTTCCAACTTTTTTCAAAACCTCAGTACGTTAAAAATTGTAACGAGTATCCTT
GATTTACTGATAGTTTGGTATGTACTTTATCTTCTCATCACGGTCTTTAAGGGAACTAAA
GCGATACAATTACTTAAAGGGATATTAGTAATTGTTATTGGTCAGCAGATAAGTATGATA
TTGAACTTGACTGCAACATCTAAATTATTCGATATCGTTATTCAATGGGGGGTATTAGCT
TTAATAGTAATATTCCAACCAGAAATTAGACGTGCGTTAGAACAACTTGGTAGAGGTAGC
TTTTTAAAACGCTATACTTCTAATACGTATAGTAAAGATGAAGAGAAATTGATTCAATCG
GTTTCAAAGGCTGTGCAATATATGGCTAAAAGACGTATAGGTGCATTAATTGTCTTTGAA
AAAGAAACAGGTCTTCAAGATTATATTGAAACAGGTATTGCAATGGATTCAAATATTTCG
CAAGAACTTTTAATTAATGTCTTTATACCTAACACACCTTTACATGATGGTGCAATGATT
ATTCAAGGCACTAAGATTGCAGCAGCAGCAAGTTATTTGCCATTGTCTGATAGTCCTAAG
ATATCTAAAAGTTTGGGTACAAGACATAGAGCTGCGGTTGGTATTTCAGAAGTATCTGAT
GCATTTACCGTTATTGTATCTGAAGAAACTGGTGATATTTCGGTAACATTTGATGGAAAA
TTACGACGAGACATTTCAAACGAAATTTTTGAAGAGTTGCTTGCTGAACATTGGTTTGGC
ACACGCTTTCAAAAGAAAGGTGTGAAATAA60
120
180
240
300
360
420
480
540
600
660
720
780
810
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1967 [new locus tag: SA_RS11285 ]
- symbol: SA1967
- description: hypothetical protein
- length: 269
- theoretical pI: 9.19244
- theoretical MW: 30078.9
- GRAVY: 0.250929
⊟Function[edit | edit source]
- reaction: EC 2.7.7.85? ExPASyDiadenylate cyclase 2 ATP = 2 diphosphate + cyclic di-3',5'-adenylate
- TIGRFAM: Hypothetical proteins Conserved TIGR00159 family protein (TIGR00159; HMM-score: 295.4)
- TheSEED :
- Hypothetical protein YbbP, contains nucleotide-binding domain of DisA bacterial checkpoint controller
- PFAM: no clan defined DAC; DisA bacterial checkpoint controller nucleotide-binding (PF02457; HMM-score: 153)and 1 moreCdaA_N; CdaA N-terminal transmembrane domain (PF19293; HMM-score: 33)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9999
- Cell wall & surface Score: 0
- Extracellular Score: 0.0001
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00094
- TAT(Tat/SPI): 0.000102
- LIPO(Sec/SPII): 0.000511
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDFSNFFQNLSTLKIVTSILDLLIVWYVLYLLITVFKGTKAIQLLKGILVIVIGQQISMILNLTATSKLFDIVIQWGVLALIVIFQPEIRRALEQLGRGSFLKRYTSNTYSKDEEKLIQSVSKAVQYMAKRRIGALIVFEKETGLQDYIETGIAMDSNISQELLINVFIPNTPLHDGAMIIQGTKIAAAASYLPLSDSPKISKSLGTRHRAAVGISEVSDAFTVIVSEETGDISVTFDGKLRRDISNEIFEELLAEHWFGTRFQKKGVK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: glmM < SA1966 < SA1967
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]