Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1773 [new locus tag: SA_RS10195 ]
- pan locus tag?: SAUPAN005063000
- symbol: SA1773
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1773 [new locus tag: SA_RS10195 ]
- symbol: SA1773
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2026271..2026555
- length: 285
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1124662 NCBI
- RefSeq: NP_375071 NCBI
- BioCyc: see SA_RS10195
- MicrobesOnline: 104097 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGTGAAATTTAAAGTTGTTAGAGCTTTTAAAGACATAGAGCACAATCAACACAAGTAC
AAAGTAGGGGAGTTGTATCCAGCTGAAGGGTATAACAATCCTCGTGTTGAATTGTTGACA
AATCAAATCAAAAATAAGTACGACAAAGTTTATATCGTACCTTTAGATAAGCTGACAAAA
CAAGAATTATTAGAACTATGCGAATCATTACAAAAAAAAGCGTCTAGTTCAATGGTTAAA
AGTGAAATCGTCGACTTATTGAATGGTGAAGACAATGACGATTGA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1773 [new locus tag: SA_RS10195 ]
- symbol: SA1773
- description: hypothetical protein
- length: 94
- theoretical pI: 6.52638
- theoretical MW: 10928.5
- GRAVY: -0.676596
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Amino acids, peptides and amines protein translocation protein, Sec62 family (TIGR00869; HMM-score: 16.4)
- TheSEED :
- Phage transcriptional terminator
- PFAM: no clan defined HEXIM; Hexamethylene bis-acetamide-inducible protein (PF15313; HMM-score: 15)and 2 moreBeta_propeller (CL0186) DPPIV_N; Dipeptidyl peptidase IV (DPP IV) N-terminal region (PF00930; HMM-score: 11.6)PLP_aminotran (CL0061) Aminotran_3; Aminotransferase class-III (PF00202; HMM-score: 10.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9602
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0.0029
- Extracellular Score: 0.0354
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007371
- TAT(Tat/SPI): 0.000159
- LIPO(Sec/SPII): 0.001402
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVKFKVVRAFKDIEHNQHKYKVGELYPAEGYNNPRVELLTNQIKNKYDKVYIVPLDKLTKQELLELCESLQKKASSSMVKSEIVDLLNGEDNDD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.