From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS12180 [old locus tag: NWMN_2105 ]
  • pan locus tag?: SAUPAN005608000
  • symbol: NWMN_RS12180
  • pan gene symbol?:
  • synonym:
  • product: MerR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS12180 [old locus tag: NWMN_2105 ]
  • symbol: NWMN_RS12180
  • product: MerR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2341784..2342200
  • length: 417
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (2341784..2342200) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_2105

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAACTAAAGAAGTCGTAGCGCTCATGAATATATCTCAAGACACTTTAAGATATTAT
    GAAAAGGTTGGTGTGATTCCACCAGTTAATCGAGATGAAAATGGATATAGAATATATAAT
    GATAGTGATTTAAATTGGATTTATTTAGTGAAAAATTTGCGAAATGCAGGCGTCAGTATT
    GAATCGCTTATCGAATTTTGCAGGTTAGCGCAGCTTCCTAAAAATGAAAATATTCAAGCA
    CAGCAAAAGCAAATTTTAAATAAGCAACTCGAAGAATTAAATGAAAACTTAAAGACAATT
    CATGATGCGAGAGATTTACTACAATATAAAATTGATAATTATGATAATCATATTGCTAAA
    ATCAATGCTAGTGATAATTATGATGACAATGTTGAACGTCTTTGGGAGAGAAAGTAA
    60
    120
    180
    240
    300
    360
    417

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS12180 [old locus tag: NWMN_2105 ]
  • symbol: NWMN_RS12180
  • description: MerR family transcriptional regulator
  • length: 138
  • theoretical pI: 5.29007
  • theoretical MW: 16340.3
  • GRAVY: -0.781159

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 63.8)
    Signal transduction Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 59.8)
    and 5 more
    Signal transduction Regulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 44.8)
    Cellular processes Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43.3)
    Signal transduction Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43.3)
    Cellular processes Cellular processes Detoxification mercuric resistence transcriptional repressor protein MerD (TIGR02054; HMM-score: 29.7)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 61.5)
    MerR; MerR family regulatory protein (PF00376; HMM-score: 49.2)
    and 6 more
    MerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 17)
    no clan defined SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 15.1)
    HTH (CL0123) HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 15.1)
    Peptidase_CA (CL0125) Phytochelatin; Phytochelatin synthase (PF05023; HMM-score: 13.3)
    PDDEXK (CL0236) Dna2; DNA replication factor Dna2 (PF08696; HMM-score: 12.8)
    no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014504
    • TAT(Tat/SPI): 0.000174
    • LIPO(Sec/SPII): 0.001416
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSIESLIEFCRLAQLPKNENIQAQQKQILNKQLEELNENLKTIHDARDLLQYKIDNYDNHIAKINASDNYDDNVERLWERK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]