Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_002530
- pan locus tag?: SAUPAN006213000
- symbol: JSNZ_002530
- pan gene symbol?: feoA
- synonym:
- product: ferrous iron transport protein A
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_002530
- symbol: JSNZ_002530
- product: ferrous iron transport protein A
- replicon: chromosome
- strand: -
- coordinates: 2537297..2537524
- length: 228
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTAAACATTAAAAATGGTGAAATGAATAAGGCTTATAAAATAAAGCGAATGGATATT
GCTAATGAGAATATGTTGTATCGTCTAAGTGCCTTTGGGTTAACAGATGACGCTATCATA
ACGATTAAACAAAAATGTTTATTTAAAGGGCCATGTATTATTGAAGTAAACGGACAACAG
TTAAGTATTAGACATTGCGATGCTTGTTCTATTGCATTAGAAGAATAG60
120
180
228
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_002530
- symbol: JSNZ_002530
- description: ferrous iron transport protein A
- length: 75
- theoretical pI: 7.9248
- theoretical MW: 8491.98
- GRAVY: -0.0906667
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: SH3 (CL0010) FeoA; FeoA domain (PF04023; HMM-score: 50.2)and 1 moreno clan defined DUF116; Protein of unknown function DUF116 (PF01976; HMM-score: 15)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9324
- Cytoplasmic Membrane Score: 0.0057
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0619
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.055744
- TAT(Tat/SPI): 0.000401
- LIPO(Sec/SPII): 0.001156
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MLNIKNGEMNKAYKIKRMDIANENMLYRLSAFGLTDDAIITIKQKCLFKGPCIIEVNGQQLSIRHCDACSIALEE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_002528 < feoB < JSNZ_002530
⊟Regulation[edit | edit source]
- regulator: Fur* (repression) regulon
Fur* (TF) important in Iron homeostasis; regulation predicted or transferred from N315 and NCTC 8325 in Wolfgramm et al. (https://doi.org/10.1101/2025.09.03.674026)
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)