Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_002528
- pan locus tag?: SAUPAN006211000
- symbol: JSNZ_002528
- pan gene symbol?: —
- synonym:
- product: FeoB-associated Cys-rich membrane protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_002528
- symbol: JSNZ_002528
- product: FeoB-associated Cys-rich membrane protein
- replicon: chromosome
- strand: -
- coordinates: 2535108..2535278
- length: 171
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGTCAGTCATTATTAACATTTTAATTTTTTTAGCAATTTTCGGATATGCCTTATATACA
CTAGTAAAATTTTTCAAGCGTTCAAAACAAGGAAAATGTGGTACATGTGACATTAATCGT
GATTGTTGTGGAACAGAACAGCACACAGCGAATCATTTTCCAGGGAAATAA60
120
171
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_002528
- symbol: JSNZ_002528
- description: FeoB-associated Cys-rich membrane protein
- length: 56
- theoretical pI: 9.0099
- theoretical MW: 6313.41
- GRAVY: 0.15
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair A/G-specific adenine glycosylase (TIGR01084; EC 3.2.2.-; HMM-score: 13.3)
- TheSEED: data available for N315, NCTC8325, Newman
- PFAM: no clan defined FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 34.1)and 1 moreTSPAN_4TM-like (CL0347) DUF2569; Protein of unknown function (DUF2569) (PF10754; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0006
- Cytoplasmic Membrane Score: 0.9949
- Cell wall & surface Score: 0
- Extracellular Score: 0.0044
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.406294
- TAT(Tat/SPI): 0.013929
- LIPO(Sec/SPII): 0.034155
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MSVIINILIFLAIFGYALYTLVKFFKRSKQGKCGTCDINRDCCGTEQHTANHFPGK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Fur* (repression) regulon
Fur* (TF) important in Iron homeostasis; transcription unit predicted or transferred from N315 and NCTC 8325 in Wolfgramm et al. (https://doi.org/10.1101/2025.09.03.674026)
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.