Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2449 [new locus tag: NWMN_RS14075 ]
- pan locus tag?: SAUPAN006211000
- symbol: NWMN_2449
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2449 [new locus tag: NWMN_RS14075 ]
- symbol: NWMN_2449
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2693411..2693581
- length: 171
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331824 NCBI
- RefSeq: YP_001333483 NCBI
- BioCyc:
- MicrobesOnline: 3708051 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGTCAGTCATTATTAACATTTTAATTTTTTTAGCAATTTTCGGATATGCCTTATATACA
CTAGTAAAATTTTTCAAGCGTTCAAAACAAGGAAAATGTGGTACATGTGACATTAATCGT
GATTGTTGTGGAACAGAACAGCACACAGCGAATCATTTTCCAGGGAAATAA60
120
171
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2449 [new locus tag: NWMN_RS14075 ]
- symbol: NWMN_2449
- description: hypothetical protein
- length: 56
- theoretical pI: 9.0099
- theoretical MW: 6313.41
- GRAVY: 0.15
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair A/G-specific adenine glycosylase (TIGR01084; EC 3.2.2.-; HMM-score: 13.3)
- TheSEED :
- FIG01108129: hypothetical protein
- PFAM: no clan defined FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 34.1)and 1 moreTSPAN_4TM-like (CL0347) DUF2569; Protein of unknown function (DUF2569) (PF10754; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0006
- Cytoplasmic Membrane Score: 0.9949
- Cell wall & surface Score: 0
- Extracellular Score: 0.0044
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.406294
- TAT(Tat/SPI): 0.013929
- LIPO(Sec/SPII): 0.034155
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSVIINILIFLAIFGYALYTLVKFFKRSKQGKCGTCDINRDCCGTEQHTANHFPGK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.