From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2565 [new locus tag: SACOL_RS13440 ]
  • symbol: SACOL2565
  • product: FeoA domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2626253..2626480
  • length: 228
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTTAAACATTAAAAATGGTGAAATGAATAAGGCTTATAAAATAAAGCGAATGGATATT
    GCTAATGAGAATATGTTGTATCGTCTAAGTGCCTTTGGGTTAACAGATGACGCTATCATA
    ACGATTAAACAAAAATGTTTATTTAAAGGGCCATGTATTATTGAAGTAAACGGACAACAG
    TTAAGTATTAGACATTGCGATGCTTGTTCTATTGCATTAGAAGAATAG
    60
    120
    180
    228

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2565 [new locus tag: SACOL_RS13440 ]
  • symbol: SACOL2565
  • description: FeoA domain-containing protein
  • length: 75
  • theoretical pI: 7.9248
  • theoretical MW: 8491.98
  • GRAVY: -0.0906667

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Ferrous iron transporter-associated protein FeoA
    CBSS-196620.1.peg.2477  Hypothetical protein FIG016644
  • PFAM:
    SH3 (CL0010) FeoA; FeoA domain (PF04023; HMM-score: 50.2)
    and 1 more
    no clan defined DUF116; Protein of unknown function DUF116 (PF01976; HMM-score: 15)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9324
    • Cytoplasmic Membrane Score: 0.0057
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0619
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.055744
    • TAT(Tat/SPI): 0.000401
    • LIPO(Sec/SPII): 0.001156
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLNIKNGEMNKAYKIKRMDIANENMLYRLSAFGLTDDAIITIKQKCLFKGPCIIEVNGQQLSIRHCDACSIALEE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: Fur* (repression) regulon

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]