From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_002186
  • pan locus tag?: SAUPAN005672000
  • symbol: JSNZ_002186
  • pan gene symbol?: cbiO1
  • synonym: ecfA1
  • product: energy-coupling factor transporter ATPase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_002186
  • symbol: JSNZ_002186
  • product: energy-coupling factor transporter ATPase
  • replicon: chromosome
  • strand: -
  • coordinates: 2200796..2201605
  • length: 810
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    GTGGAGGATAAGAATTCAGTTATTGTATTTAAAAATGTTTCATTTCAATATCAAAGTGAT
    GCATCCTTCACATTGAAAGATGTTTCTTTTAGTATACCTAAAGGTCAGTGGACATCTATT
    GTTGGTCATAACGGTTCTGGAAAATCTACAATTGCCAAGTTAATGATTGGCATAGAGAAA
    GTTAAATCTGGAGAAATTTTTTATAATAATCAAGCTATAACAGATGATAATTTTGAAAAG
    TTAAGAAAAGACATAGGAATTGTATTTCAGAATCCGGATAATCAATTTGTTGGTTCAATT
    GTAAAATACGATGTGGCATTTGGACTCGAAAATCATGCGGTTCCACATGACGAAATGCAT
    AGAAGAGTCAGCGAAGCACTTAAACAAGTTGATATGTTAGAACGTGCAGATTATGAACCT
    AATGCATTATCGGGGGGACAGAAGCAGCGTGTGGCTATAGCAAGTGTATTAGCACTTAAC
    CCCTCTGTCATTATATTAGATGAGGCGACTTCTATGTTAGATCCTGATGCACGTCAAAAT
    TTATTGGATTTAGTGAGAAAAGTTAAATCAGAACATAATATTACAATCATTTCTATTACG
    CATGATTTATCTGAGGCGATGGAAGCAGATCATGTTATCGTTATGAATAAAGGGACTGTC
    CATAAAGAAGGCACAGCGATTGAAATTTTCGACCATGCAGAAGAGTTAACAACAATAGGT
    CTAGATTTGCCATTCCCAATCAAAATAAATCAAATGCTGGGACACCAAACATCATTCTTA
    ACTTATGAAGGGCTGGTGGATCAACTATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    810

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_002186
  • symbol: JSNZ_002186
  • description: energy-coupling factor transporter ATPase
  • length: 269
  • theoretical pI: 5.02744
  • theoretical MW: 29950.8
  • GRAVY: -0.197026

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 345.1)
    and 78 more
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 243.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 172.5)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 166.7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 160.7)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 153.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 153.5)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 151.8)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 151.4)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 149.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 148.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 147.4)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 146)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 144)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 141.6)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 136.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 136.8)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 136.5)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 134.5)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 133.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 133.6)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 133.3)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 132.1)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 132.1)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 130.3)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 130.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 129.7)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 127.6)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 125.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 123.3)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 123.1)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 117.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 117.4)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 117.4)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 117.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 116.5)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 116.3)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 116.3)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 113.4)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 113.3)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 112)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 111.8)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 110.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 108.3)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 101.5)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 101.5)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 98.6)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 94.9)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 94.6)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 93.5)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 93)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 91.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 90)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 82.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 81.9)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 81.9)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 80.4)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 80.4)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 79.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 76.2)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 74.3)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 74)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 71.8)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 71.8)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 69.4)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 62.7)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 62.5)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 51.7)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 44.7)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 42.9)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 41.4)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 24.8)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 24.8)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 15.5)
    rad50 (TIGR00606; HMM-score: 15.4)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 14.1)
    KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 13.8)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 13.3)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 13.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 122.9)
    and 24 more
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 58.9)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 30.3)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 21.3)
    AAA_22; AAA domain (PF13401; HMM-score: 20.3)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 19.6)
    AAA_23; AAA domain (PF13476; HMM-score: 19.2)
    SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 19.2)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 18.8)
    AAA_33; AAA domain (PF13671; HMM-score: 17.1)
    DEAD; DEAD/DEAH box helicase (PF00270; HMM-score: 16.5)
    TniB; Bacterial TniB protein (PF05621; HMM-score: 16.4)
    AAA_25; AAA domain (PF13481; HMM-score: 15)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 14.7)
    RecA; recA bacterial DNA recombination protein (PF00154; HMM-score: 14.1)
    KdpD; Osmosensitive K+ channel His kinase sensor domain (PF02702; HMM-score: 13.9)
    ATPase; KaiC (PF06745; HMM-score: 13.8)
    ABC_ATPase; P-loop domain (PF09818; HMM-score: 13.4)
    AAA_14; AAA domain (PF13173; HMM-score: 12.9)
    AAA_17; AAA domain (PF13207; HMM-score: 12.6)
    AAA_13; AAA domain (PF13166; HMM-score: 12.4)
    ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.3)
    TIM_barrel (CL0036) Spherulin4; Spherulation-specific family 4 (PF12138; HMM-score: 11.9)
    P-loop_NTPase (CL0023) AAA_18; AAA domain (PF13238; HMM-score: 11.7)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 11.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0983
    • Cytoplasmic Membrane Score: 0.8961
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0051
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009666
    • TAT(Tat/SPI): 0.000437
    • LIPO(Sec/SPII): 0.002059
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MEDKNSVIVFKNVSFQYQSDASFTLKDVSFSIPKGQWTSIVGHNGSGKSTIAKLMIGIEKVKSGEIFYNNQAITDDNFEKLRKDIGIVFQNPDNQFVGSIVKYDVAFGLENHAVPHDEMHRRVSEALKQVDMLERADYEPNALSGGQKQRVAIASVLALNPSVIILDEATSMLDPDARQNLLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNKGTVHKEGTAIEIFDHAEELTTIGLDLPFPIKINQMLGHQTSFLTYEGLVDQL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]