Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_002186
- pan locus tag?: SAUPAN005672000
- symbol: JSNZ_002186
- pan gene symbol?: cbiO1
- synonym: ecfA1
- product: energy-coupling factor transporter ATPase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_002186
- symbol: JSNZ_002186
- product: energy-coupling factor transporter ATPase
- replicon: chromosome
- strand: -
- coordinates: 2200796..2201605
- length: 810
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781GTGGAGGATAAGAATTCAGTTATTGTATTTAAAAATGTTTCATTTCAATATCAAAGTGAT
GCATCCTTCACATTGAAAGATGTTTCTTTTAGTATACCTAAAGGTCAGTGGACATCTATT
GTTGGTCATAACGGTTCTGGAAAATCTACAATTGCCAAGTTAATGATTGGCATAGAGAAA
GTTAAATCTGGAGAAATTTTTTATAATAATCAAGCTATAACAGATGATAATTTTGAAAAG
TTAAGAAAAGACATAGGAATTGTATTTCAGAATCCGGATAATCAATTTGTTGGTTCAATT
GTAAAATACGATGTGGCATTTGGACTCGAAAATCATGCGGTTCCACATGACGAAATGCAT
AGAAGAGTCAGCGAAGCACTTAAACAAGTTGATATGTTAGAACGTGCAGATTATGAACCT
AATGCATTATCGGGGGGACAGAAGCAGCGTGTGGCTATAGCAAGTGTATTAGCACTTAAC
CCCTCTGTCATTATATTAGATGAGGCGACTTCTATGTTAGATCCTGATGCACGTCAAAAT
TTATTGGATTTAGTGAGAAAAGTTAAATCAGAACATAATATTACAATCATTTCTATTACG
CATGATTTATCTGAGGCGATGGAAGCAGATCATGTTATCGTTATGAATAAAGGGACTGTC
CATAAAGAAGGCACAGCGATTGAAATTTTCGACCATGCAGAAGAGTTAACAACAATAGGT
CTAGATTTGCCATTCCCAATCAAAATAAATCAAATGCTGGGACACCAAACATCATTCTTA
ACTTATGAAGGGCTGGTGGATCAACTATGA60
120
180
240
300
360
420
480
540
600
660
720
780
810
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_002186
- symbol: JSNZ_002186
- description: energy-coupling factor transporter ATPase
- length: 269
- theoretical pI: 5.02744
- theoretical MW: 29950.8
- GRAVY: -0.197026
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 345.1)and 78 moreTransport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 243.6)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 172.5)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 166.7)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 160.7)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 153.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 153.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 151.8)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 151.4)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 149.2)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 148.9)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 147.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 146)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 144)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 141.6)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 136.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 136.8)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 136.5)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 134.5)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 133.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 133.6)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 133.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 132.1)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 132.1)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 130.3)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 130.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 129.7)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 127.6)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 125.6)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 123.3)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 123.1)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 117.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 117.4)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 117.4)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 117.4)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 116.5)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 116.3)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 116.3)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 113.4)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 113.3)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 112)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 111.8)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 110.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 108.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 101.5)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 101.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 98.6)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 94.9)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 94.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 93.5)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 93)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 91.9)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 90)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 82.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 81.9)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 81.9)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 80.4)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 80.4)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 79.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 76.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 74.3)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 74)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 71.8)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 71.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 69.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 62.7)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 62.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 51.7)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 44.7)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 42.9)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 41.4)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 24.8)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 24.8)DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 15.5)rad50 (TIGR00606; HMM-score: 15.4)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 14.1)KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 13.8)Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 13.3)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 13.3)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 122.9)and 24 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 58.9)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 30.3)AAA_15; AAA ATPase domain (PF13175; HMM-score: 21.3)AAA_22; AAA domain (PF13401; HMM-score: 20.3)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 19.6)AAA_23; AAA domain (PF13476; HMM-score: 19.2)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 19.2)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 18.8)AAA_33; AAA domain (PF13671; HMM-score: 17.1)DEAD; DEAD/DEAH box helicase (PF00270; HMM-score: 16.5)TniB; Bacterial TniB protein (PF05621; HMM-score: 16.4)AAA_25; AAA domain (PF13481; HMM-score: 15)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 14.7)RecA; recA bacterial DNA recombination protein (PF00154; HMM-score: 14.1)KdpD; Osmosensitive K+ channel His kinase sensor domain (PF02702; HMM-score: 13.9)ATPase; KaiC (PF06745; HMM-score: 13.8)ABC_ATPase; P-loop domain (PF09818; HMM-score: 13.4)AAA_14; AAA domain (PF13173; HMM-score: 12.9)AAA_17; AAA domain (PF13207; HMM-score: 12.6)AAA_13; AAA domain (PF13166; HMM-score: 12.4)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.3)TIM_barrel (CL0036) Spherulin4; Spherulation-specific family 4 (PF12138; HMM-score: 11.9)P-loop_NTPase (CL0023) AAA_18; AAA domain (PF13238; HMM-score: 11.7)ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0983
- Cytoplasmic Membrane Score: 0.8961
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0051
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009666
- TAT(Tat/SPI): 0.000437
- LIPO(Sec/SPII): 0.002059
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MEDKNSVIVFKNVSFQYQSDASFTLKDVSFSIPKGQWTSIVGHNGSGKSTIAKLMIGIEKVKSGEIFYNNQAITDDNFEKLRKDIGIVFQNPDNQFVGSIVKYDVAFGLENHAVPHDEMHRRVSEALKQVDMLERADYEPNALSGGQKQRVAIASVLALNPSVIILDEATSMLDPDARQNLLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNKGTVHKEGTAIEIFDHAEELTTIGLDLPFPIKINQMLGHQTSFLTYEGLVDQL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : rpsI < rplM < truA < JSNZ_002184 < JSNZ_002185 < JSNZ_002186
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)