From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_002171
  • pan locus tag?: SAUPAN005608000
  • symbol: JSNZ_002171
  • pan gene symbol?: —
  • synonym:
  • product: MerR family transcriptional regulator

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_002171
  • symbol: JSNZ_002171
  • product: MerR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2187557..2187973
  • length: 417
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAACTAAAGAAGTCGTAGCGCTCATGAATATATCTCAAGACACTTTAAGATATTAT
    GAAAAGGTTGGTGTGATTCCACCCGTTAATCGAGATGAAAATGGATATAGAATATATAAT
    GATAGTGATTTAAATTGGATTTATTTAGTGAAAAATTTGCGAAATGCAGGCGTCAGTATT
    GAATCGCTTATCGAATTTTGTAGATTAGCGCAGCTTCCTAAAAATAAAAATATTCAAACA
    CAGCAAAAGCAAATTTTAAATAAGCAACTCGAAGAATTAAATGAAAACTTAAAGACAATT
    CATGATGCGAGAGATTTACTAAAATATAAAATTGATAATTATGATAATCATATTGCTAAA
    ATCAATGCTAGTGATAATCATGATGACAATGTTGAACGTCTTTGGGAGAGAAAGTAA
    60
    120
    180
    240
    300
    360
    417

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_002171
  • symbol: JSNZ_002171
  • description: MerR family transcriptional regulator
  • length: 138
  • theoretical pI: 7.59288
  • theoretical MW: 16343.4
  • GRAVY: -0.818841

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 63)
    Signal transduction Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 58.5)
    and 5 more
    Signal transduction Regulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 44.5)
    Cellular processes Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43)
    Signal transduction Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43)
    Cellular processes Cellular processes Detoxification mercuric resistence transcriptional repressor protein MerD (TIGR02054; HMM-score: 28.8)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 61.6)
    MerR; MerR family regulatory protein (PF00376; HMM-score: 51.7)
    and 12 more
    MerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 16)
    GME (CL0197) PAD; Protein-arginine deiminase (PAD) (PF03068; HMM-score: 14.5)
    no clan defined DUF6397; Family of unknown function (DUF6397) (PF19934; HMM-score: 14.3)
    HTH (CL0123) Rep3_C; Initiator Rep protein, WH2 (PF21205; HMM-score: 14.3)
    Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 14.2)
    Peptidase_CA (CL0125) Phytochelatin; Phytochelatin synthase (PF05023; HMM-score: 14)
    HTH (CL0123) HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14)
    ATP-grasp (CL0179) DNA_ligase_aden; NAD-dependent DNA ligase adenylation domain (PF01653; HMM-score: 13.8)
    GT-B (CL0113) RickCE_N; RickCE N-terminal (PF22189; HMM-score: 13.1)
    no clan defined DUF5320; Family of unknown function (DUF5320) (PF17253; HMM-score: 12.9)
    Tail_Terminator (CL0691) Phage_tail_terminator_7; Bacteriophage Tail Tube Terminator Protein (PF23818; HMM-score: 12.6)
    no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 10.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9496
    • Cytoplasmic Membrane Score: 0.0005
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0495
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014504
    • TAT(Tat/SPI): 0.000174
    • LIPO(Sec/SPII): 0.001416
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSIESLIEFCRLAQLPKNKNIQTQQKQILNKQLEELNENLKTIHDARDLLKYKIDNYDNHIAKINASDNHDDNVERLWERK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: CodY (repression) regulon
    CodY(TF)important in Amino acid metabolism;  regulation predicted or transferred from N315 and NCTC 8325  [2]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_002171&oldid=107812"