From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001585
  • pan locus tag?: SAUPAN004181000
  • symbol: yhbY
  • pan gene symbol?: —
  • synonym:
  • product: ribosome assembly RNA-binding protein YhbY

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001585
  • symbol: yhbY
  • product: ribosome assembly RNA-binding protein YhbY
  • replicon: chromosome
  • strand: -
  • coordinates: 1620953..1621243
  • length: 291
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCTTACTGGCAAACAAAAAAGATACTTAAGAAGTTTAGCACACAATATTGATCCGATT
    TTTCAAATTGGAAAAGGCGGTATCAACGAAAATATGATTAAACAAATAGATGATACGTTA
    GAAAACAGAGAATTGATTAAAGTACATGTACTACAAAATAACTTTGATGATAAAAAAGAA
    TTAGCTGAAACATTAAGCGAAGCTACGCATAGTGAATTAGTGCAAGTGATTGGATCTATG
    ATAGTGATTTATAGAGAATCTAAAGATAATAAAGAAATTGAATTGCCATAA
    60
    120
    180
    240
    291

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_001585
  • symbol: YhbY
  • description: ribosome assembly RNA-binding protein YhbY
  • length: 96
  • theoretical pI: 5.65938
  • theoretical MW: 11047.6
  • GRAVY: -0.521875

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function General putative RNA-binding protein, YhbY family (TIGR00253; HMM-score: 130)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined CRS1_YhbY; CRS1 / YhbY (CRM) domain (PF01985; HMM-score: 116)
    and 4 more
    HMA (CL0704) HMA_2; Heavy metal associated domain 2 (PF19991; HMM-score: 16.4)
    no clan defined DUF1217; Protein of unknown function (DUF1217) (PF06748; HMM-score: 12.8)
    NADP_Rossmann (CL0063) NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 12.5)
    TIM_barrel (CL0036) Glyco_hydro_59; Glycosyl hydrolase family 59 (PF02057; HMM-score: 11.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9894
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0102
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002297
    • TAT(Tat/SPI): 0.00015
    • LIPO(Sec/SPII): 0.000525
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKELAETLSEATHSELVQVIGSMIVIYRESKDNKEIELP

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_001585&oldid=107226"