Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001005
- pan locus tag?: SAUPAN003243000
- symbol: JSNZ_001005
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001005
- symbol: JSNZ_001005
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1006853..1006957
- length: 105
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61GTGAAAAAAGACGAAGAAAGAAGTGAAATGAATGGCTACGGGCGTATTAGAGGACGATAT
TGTCAAAGAGATATATGGCAGCTCAAAGGAATGGGTTTCAGTTGA60
105
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001005
- symbol: JSNZ_001005
- description: hypothetical protein
- length: 34
- theoretical pI: 9.88201
- theoretical MW: 4126.71
- GRAVY: -1.33824
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4841
- Cytoplasmic Membrane Score: 0.0028
- Cell wall & surface Score: 0
- Extracellular Score: 0.5131
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.316875
- TAT(Tat/SPI): 0.050908
- LIPO(Sec/SPII): 0.10176
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MKKDEERSEMNGYGRIRGRYCQRDIWQLKGMGFS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_001005 > JSNZ_001006 > menD > menH > menB
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)