From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000910
  • pan locus tag?: SAUPAN003048000
  • symbol: mnhF1
  • pan gene symbol?: mnhF1
  • synonym:
  • product: Na+/H+ antiporter Mnh1 subunit F

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000910
  • symbol: mnhF1
  • product: Na+/H+ antiporter Mnh1 subunit F
  • replicon: chromosome
  • strand: -
  • coordinates: 906573..906866
  • length: 294
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAATCATAATGTTATTATCGTTATTGCATTAATCATAGTTGTCATTTCTATGTTAGCT
    ATGCTCATTCGCGTTGTGCTAGGCCCATCACTTGCCGATCGTGTTGTCGCATTAGATGCG
    ATTGGTCTTCAATTAATGGCAGTTATAGCATTATTCAGTATTTTATTAAATATTAAATAC
    ATGATTGTCGTTATTATGATGATTGGTATATTAGCTTTTTTAGGTACTGCAGTATTCTCT
    AAATTTATGGACAAAGGTAAGGTGATTGAACATGATCAAAATCATACTGATTAG
    60
    120
    180
    240
    294

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_000910
  • symbol: MnhF1
  • description: Na+/H+ antiporter Mnh1 subunit F
  • length: 97
  • theoretical pI: 7.7971
  • theoretical MW: 10616.1
  • GRAVY: 1.3701

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 9.9)
    and 1 more
    TIGR03943 family protein (TIGR03943; HMM-score: 6.5)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined MrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 50.1)
    and 1 more
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 11.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9995
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0005
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.033588
    • TAT(Tat/SPI): 0.000316
    • LIPO(Sec/SPII): 0.021791
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKYMIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]