Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0850 [new locus tag: SAUSA300_RS04590 ]
- pan locus tag?: SAUPAN003048000
- symbol: mnhF
- pan gene symbol?: mnhF1
- synonym:
- product: putative monovalent cation/H+ antiporter subunit F
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0850 [new locus tag: SAUSA300_RS04590 ]
- symbol: mnhF
- product: putative monovalent cation/H+ antiporter subunit F
- replicon: chromosome
- strand: -
- coordinates: 928664..928957
- length: 294
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913003 NCBI
- RefSeq: YP_493550 NCBI
- BioCyc: see SAUSA300_RS04590
- MicrobesOnline: 1292365 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATCATAATGTTATTATCGTTATTGCATTAATCATAGTTGTCATTTCTATGTTAGCT
ATGCTCATTCGCGTTGTGCTAGGCCCATCACTTGCCGATCGTGTTGTCGCATTAGATGCG
ATTGGTCTTCAATTAATGGCAGTTATAGCATTATTCAGTATTTTATTAAATATTAAATAC
ATGATTGTCGTTATTATGATGATTGGTATATTAGCTTTTTTAGGTACTGCAGTATTCTCT
AAATTTATGGACAAAGGTAAGGTGATTGAACATGATCAAAATCATACTGATTAG60
120
180
240
294
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0850 [new locus tag: SAUSA300_RS04590 ]
- symbol: MnhF
- description: putative monovalent cation/H+ antiporter subunit F
- length: 97
- theoretical pI: 7.7971
- theoretical MW: 10616.1
- GRAVY: 1.3701
⊟Function[edit | edit source]
- reaction: EC 2.3.1.-? ExPASy
- TIGRFAM: Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 9.9)and 1 moreTIGR03943 family protein (TIGR03943; HMM-score: 6.5)
- TheSEED :
- Na(+) H(+) antiporter subunit F (TC 2.A.63.1.3)
- PFAM: no clan defined MrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 50.1)and 1 moreDUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9995
- Cell wall & surface Score: 0
- Extracellular Score: 0.0005
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.033588
- TAT(Tat/SPI): 0.000316
- LIPO(Sec/SPII): 0.021791
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKYMIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
- ↑ Manisha Vaish, Alexa Price-Whelan, Tamara Reyes-Robles, Jun Liu, Amyeo Jereen, Stephanie Christie, Francis Alonzo, Meredith A Benson, Victor J Torres, Terry A Krulwich
Roles of Staphylococcus aureus Mnh1 and Mnh2 Antiporters in Salt Tolerance, Alkali Tolerance, and Pathogenesis.
J Bacteriol: 2018, 200(5);
[PubMed:29263099] [WorldCat.org] [DOI] (I e)