Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000794
- pan locus tag?: SAUPAN002835000
- symbol: JSNZ_000794
- pan gene symbol?: —
- synonym:
- product: toprim domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000794
- symbol: JSNZ_000794
- product: toprim domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 825648..826034
- length: 387
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGCTATTGTAAATAAAGTGATAATTGTTGAAGGAAAATCTGATAAAAAAAGGGTGCAA
CAGGTTATTGCAGAACCAGTCAATATTATTTGTACTCATGGAACAATGAGTATAGATAAG
CTTGATGATATGATAGAATCACTGTATGATAAACAAGTTTTTGTATTAGCCGATTCTGAT
GACGAAGGAGATCGAATTAGAAATTGGTTTAAACGTTATTTGAGTGAAAGTGAACATATA
TTTATTGATAAAACTTACTGTCAAGTTGCGAATTGCCCCAAACAATATTTGGCGCATGTA
CTTTCAAAACATGGCTTTACTTGTAAGAAAGAAACACCTCTTTTACCGAATATAAATAAT
GAAAGGTTAGTTTTAGTAAATGAATAA60
120
180
240
300
360
387
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000794
- symbol: JSNZ_000794
- description: toprim domain-containing protein
- length: 128
- theoretical pI: 6.505
- theoretical MW: 14751.9
- GRAVY: -0.304688
⊟Function[edit | edit source]
- TIGRFAM: Transcription RNA processing ribonuclease M5 (TIGR00334; EC 3.1.26.8; HMM-score: 51.5)and 1 moreDNA metabolism DNA replication, recombination, and repair DNA gyrase, B subunit (TIGR01059; EC 5.99.1.3; HMM-score: 14.6)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Toprim-like (CL0413) Toprim; Toprim domain (PF01751; HMM-score: 34.1)and 5 moreOLD-like_TOPRIM; Overcoming lysogenization defect protein-like, TOPRIM domain (PF20469; HMM-score: 17.8)Toprim_2; Toprim-like (PF13155; HMM-score: 16.3)no clan defined DUF2100; Uncharacterized protein conserved in archaea (DUF2100) (PF09873; HMM-score: 15.2)Toprim-like (CL0413) Toprim_4; Toprim domain (PF13662; HMM-score: 14.6)no clan defined Calc_CGRP_IAPP; Calcitonin / CGRP / IAPP family (PF00214; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9775
- Cytoplasmic Membrane Score: 0.0064
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0159
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004075
- TAT(Tat/SPI): 0.000121
- LIPO(Sec/SPII): 0.000642
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLADSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPNINNERLVLVNE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_000794 > JSNZ_000795
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
SigB (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; regulation predicted or transferred from N315 and NCTC 8325 in Wolfgramm et al. (https://doi.org/10.1101/2025.09.03.674026) other strains
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)