Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0778 [new locus tag: NWMN_RS04405 ]
- pan locus tag?: SAUPAN002835000
- symbol: NWMN_0778
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0778 [new locus tag: NWMN_RS04405 ]
- symbol: NWMN_0778
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 868976..869371
- length: 396
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330457 NCBI
- RefSeq: YP_001331812 NCBI
- BioCyc:
- MicrobesOnline: 3706327 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361GTGATGATGATGGCTATTGTAAATAAAGTGATAATTGTTGAAGGAAAATCTGATAAAAAA
AGGGTGCAACAGGTTATTGCAGAACCAGTCAATATTATTTGTACTCATGGAACAATGAGT
ATAGATAAGCTTGATGATATGATAGAATCACTGTATGATAAACAAGTTTTTGTATTAGCC
GATTCTGATGACGAAGGAGATCGAATTAGAAATTGGTTTAAACGTTATTTGAGTGAAAGT
GAACATATATTTATTGATAAAACTTACTGTCAAGTTGCGAATTGCCCCAAACAATATTTG
GCGCATGTACTTTCAAAACATGGCTTTACTTGTAAGAAAGAAACACCTCTTTTACCGAAT
ATAAATAATGAAAGGTTAGTTTTAGTAAATGAATAA60
120
180
240
300
360
396
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0778 [new locus tag: NWMN_RS04405 ]
- symbol: NWMN_0778
- description: hypothetical protein
- length: 131
- theoretical pI: 6.505
- theoretical MW: 15145.5
- GRAVY: -0.254198
⊟Function[edit | edit source]
- TIGRFAM: Transcription RNA processing ribonuclease M5 (TIGR00334; EC 3.1.26.8; HMM-score: 51.4)and 1 moreDNA metabolism DNA replication, recombination, and repair DNA gyrase, B subunit (TIGR01059; EC 5.99.1.3; HMM-score: 15.1)
- TheSEED :
- Toprim domain protein
- PFAM: Toprim-like (CL0413) Toprim; Toprim domain (PF01751; HMM-score: 34)and 5 moreOLD-like_TOPRIM; Overcoming lysogenization defect protein-like, TOPRIM domain (PF20469; HMM-score: 17.7)Toprim_2; Toprim-like (PF13155; HMM-score: 16.3)no clan defined DUF2100; Uncharacterized protein conserved in archaea (DUF2100) (PF09873; HMM-score: 15.1)Toprim-like (CL0413) Toprim_4; Toprim domain (PF13662; HMM-score: 14.5)no clan defined Calc_CGRP_IAPP; Calcitonin / CGRP / IAPP family (PF00214; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.78
- Cytoplasmic Membrane Score: 8.16
- Cellwall Score: 0.06
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9822
- Cytoplasmic Membrane Score: 0.0044
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0133
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006879
- TAT(Tat/SPI): 0.000282
- LIPO(Sec/SPII): 0.00147
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMMMAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLADSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPNINNERLVLVNE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)