Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000595
- pan locus tag?: SAUPAN002500000
- symbol: mnhF2
- pan gene symbol?: mnhF2
- synonym: mrpF2
- product: Na+/H+ antiporter Mnh2 subunit F
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000595
- symbol: mnhF2
- product: Na+/H+ antiporter Mnh2 subunit F
- replicon: chromosome
- strand: +
- coordinates: 629221..629523
- length: 303
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATACAAACAATGACACATATTATGATTATTAGTTCACTCATTATTTTTGGAATTGCA
TTAATCATCTGTTTATTTAGATTAATCAAGGGACCTACAACAGCAGATCGTGTCGTTACA
TTTGATACAACAAGTGCTGTCGTAATGTCAATTGTGGGTGTGTTAAGTGTACTTATGGGC
ACCGTTTCTTTCTTAGATTCAATCATGCTCATTGCCATTATATCTTTTGTAAGTTCTGTT
TCAATATCACGCTTTATTGGTGGGGGGCATGTGTTTAATGGAAATAACAAAAGAAATCTT
TAG60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000595
- symbol: MnhF2
- description: Na+/H+ antiporter Mnh2 subunit F
- length: 100
- theoretical pI: 10.7502
- theoretical MW: 10747.9
- GRAVY: 1.174
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance circular bacteriocin, circularin A/uberolysin family (TIGR03651; HMM-score: 5.5)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined MrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 48.2)and 2 moreFumRed-TM (CL0335) Fumarate_red_C; Fumarate reductase subunit C (PF02300; HMM-score: 12.5)no clan defined DUF202; Domain of unknown function (DUF202) (PF02656; HMM-score: 8.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9994
- Cell wall & surface Score: 0
- Extracellular Score: 0.0006
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.023346
- TAT(Tat/SPI): 0.000367
- LIPO(Sec/SPII): 0.014334
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MIQTMTHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMGTVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)