Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000591
- pan locus tag?: SAUPAN002495000
- symbol: mnhB2
- pan gene symbol?: mnhB2
- synonym:
- product: Na+/H+ antiporter Mnh2 subunit B
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000591
- symbol: mnhB2
- product: Na+/H+ antiporter Mnh2 subunit B
- replicon: chromosome
- strand: +
- coordinates: 626489..626914
- length: 426
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAAGAGAATGATGTCGTGTTAAGAACGGTCACGAAACTTGTTGTATTTATTTTATTG
ACTTTCGGATTCTATGTCTTCTTCGCAGGTCATAATAATCCTGGTGGTGGGTTTATTGGT
GGTTTAATATTTAGTTCAGCGTTTATTTTAATGTTTCTGGCTTTTAATGTTGAAGAGGTT
TTAGAAAGTTTACCGATTGATTTTAGAATTTTAATGATTATTGGAGCATTGGTATCATCT
ATTACTGCGATAATACCTATGTTTTTTGGAAAACCATTTTTGTCTCAATATGAAACAACT
TGGATACTTCCAATTTTAGGACAAATTCATGTAAGTACAATAACACTTTTTGAATTAGGT
ATTTTATTCTCAGTTGTTGGTGTTATTGTCACAGTGATGTTGTCGCTTAGCGGAGGTCGA
TCATGA60
120
180
240
300
360
420
426
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000591
- symbol: MnhB2
- description: Na+/H+ antiporter Mnh2 subunit B
- length: 141
- theoretical pI: 5.6084
- theoretical MW: 15454.4
- GRAVY: 1.15035
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds monovalent cation:proton antiporter (TIGR00943; HMM-score: 103.6)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined MnhB; Domain related to MnhB subunit of Na+/H+ antiporter (PF04039; HMM-score: 117.6)and 3 moreHyr1; Hyphally regulated cell wall GPI-anchored protein 1 (PF15789; HMM-score: 11.8)DUF3493; Low psii accumulation1 / Rep27 (PF11998; HMM-score: 7.8)Cupin (CL0029) POPDC1-3; POPDC1-3 (PF04831; HMM-score: 6.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9995
- Cell wall & surface Score: 0
- Extracellular Score: 0.0004
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004138
- TAT(Tat/SPI): 0.000248
- LIPO(Sec/SPII): 0.008493
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEVLESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELGILFSVVGVIVTVMLSLSGGRS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)