From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000536
  • pan locus tag?: SAUPAN002356000
  • symbol: vraX
  • pan gene symbol?: vraX
  • synonym:
  • product: C1q-binding complement inhibitor VraX

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000536
  • symbol: vraX
  • product: C1q-binding complement inhibitor VraX
  • replicon: chromosome
  • strand: -
  • coordinates: 578677..578844
  • length: 168
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGATTATTTATCGACAGTATCACCATGAAGGCGCACCAGTTTATGAAATTATAACCAAA
    ACGTTTCAGCATGTTTCAATTAAATGTGACGATTCATTTAGTGATACTGAAATATTCAAA
    TTGCTCTCTTTATTACAAGACGATATAGATCATATGAAAGTTAGTTAA
    60
    120
    168

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_000536
  • symbol: VraX
  • description: C1q-binding complement inhibitor VraX
  • length: 55
  • theoretical pI: 5.43379
  • theoretical MW: 6500.38
  • GRAVY: -0.201818

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman
  • PFAM:
    no clan defined VraX; Family of unknown function (PF17412; HMM-score: 135.5)
    and 1 more
    WY-like (CL0807) RXLR_WY; RXLR phytopathogen effector protein WY-domain (PF18634; HMM-score: 12.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.569
    • Cytoplasmic Membrane Score: 0.0701
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.3605
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00804
    • TAT(Tat/SPI): 0.000622
    • LIPO(Sec/SPII): 0.011168
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: VraR (activation) regulon
    VraR(TF)response regulator important for resistance against cell-wall targeting antibiotics;  [1] [2]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Makoto Kuroda, Hiroko Kuroda, Taku Oshima, Fumihiko Takeuchi, Hirotada Mori, Keiichi Hiramatsu
    Two-component system VraSR positively modulates the regulation of cell-wall biosynthesis pathway in Staphylococcus aureus.
    Mol Microbiol: 2003, 49(3);807-21
    [PubMed:12864861] [WorldCat.org] [DOI] (P p)
  2. ↑ Susan Boyle-Vavra, Shouhui Yin, Dae Sun Jo, Christopher P Montgomery, Robert S Daum
    VraT/YvqF is required for methicillin resistance and activation of the VraSR regulon in Staphylococcus aureus.
    Antimicrob Agents Chemother: 2013, 57(1);83-95
    [PubMed:23070169] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_000536&oldid=106177"