Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0542 [new locus tag: NWMN_RS03115 ]
- pan locus tag?: SAUPAN002356000
- symbol: NWMN_0542
- pan gene symbol?: vraX
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0542 [new locus tag: NWMN_RS03115 ]
- symbol: NWMN_0542
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 626967..627134
- length: 168
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330288 NCBI
- RefSeq: YP_001331576 NCBI
- BioCyc:
- MicrobesOnline: 3706089 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATTATTTATCGACAGTATCACCATGAAGGCGCACCAGTTTATGAAATTATAACCAAA
ACGTTTCAGCATGTTTCAATTAAATGTGACGATTCATTTAGTGATACTGAAATATTCAAA
TTGCTCTCTTTATTACAAGACGATATAGATCATATGAAAGTTAGTTAA60
120
168
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0542 [new locus tag: NWMN_RS03115 ]
- symbol: NWMN_0542
- description: hypothetical protein
- length: 55
- theoretical pI: 5.43379
- theoretical MW: 6500.38
- GRAVY: -0.201818
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108195: hypothetical protein
- PFAM: no clan defined VraX; Family of unknown function (PF17412; HMM-score: 135.5)and 1 moreWY-like (CL0807) RXLR_WY; RXLR phytopathogen effector protein WY-domain (PF18634; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.569
- Cytoplasmic Membrane Score: 0.0701
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.3605
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00804
- TAT(Tat/SPI): 0.000622
- LIPO(Sec/SPII): 0.011168
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: VraR (activation) regulon
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Makoto Kuroda, Hiroko Kuroda, Taku Oshima, Fumihiko Takeuchi, Hirotada Mori, Keiichi Hiramatsu
Two-component system VraSR positively modulates the regulation of cell-wall biosynthesis pathway in Staphylococcus aureus.
Mol Microbiol: 2003, 49(3);807-21
[PubMed:12864861] [WorldCat.org] [DOI] (P p) - ↑ Susan Boyle-Vavra, Shouhui Yin, Dae Sun Jo, Christopher P Montgomery, Robert S Daum
VraT/YvqF is required for methicillin resistance and activation of the VraSR regulon in Staphylococcus aureus.
Antimicrob Agents Chemother: 2013, 57(1);83-95
[PubMed:23070169] [WorldCat.org] [DOI] (I p)