From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000535
  • pan locus tag?: SAUPAN002355000
  • symbol: JSNZ_000535
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000535
  • symbol: JSNZ_000535
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 578207..578476
  • length: 270
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAGTTTAATGAGATATGGATAAATGAATATTTGGCGCTCGTAAATGATGATAATCCA
    ATACATAATGAGATTGTGCCAGGACAATTAGTGAGTCAAATGATGCTGATGGCTATGTCA
    TTAGAGACAAACCAGTGTCAAATTAACTACGTTAAACCTATTTTAATAAATGAAAATATC
    GAATTCATTGAACAACACGAACACGAAATTATAGCAATTAATGACGATGGAGAGATTAAA
    ATAAAAATTTCTTTGAGCACAAAAAAATAA
    60
    120
    180
    240
    270

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_000535
  • symbol: JSNZ_000535
  • description: hypothetical protein
  • length: 89
  • theoretical pI: 4.32027
  • theoretical MW: 10352.9
  • GRAVY: -0.160674

Function[edit | edit source]

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9778
    • Cytoplasmic Membrane Score: 0.0166
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0052
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007747
    • TAT(Tat/SPI): 0.000171
    • LIPO(Sec/SPII): 0.000657
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MKFNEIWINEYLALVNDDNPIHNEIVPGQLVSQMMLMAMSLETNQCQINYVKPILINENIEFIEQHEHEIIAINDDGEIKIKISLSTKK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: BirA* (repression) regulon
    BirA*(TF)important in Biotin biosynthesis;  transcription unit predicted or transferred from N315 and NCTC8325 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]