Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000328
- pan locus tag?: SAUPAN001973000
- symbol: JSNZ_000328
- pan gene symbol?: —
- synonym:
- product: GlsB/YeaQ/YmgE family stress response membrane protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000328
- symbol: JSNZ_000328
- product: GlsB/YeaQ/YmgE family stress response membrane protein
- replicon: chromosome
- strand: +
- coordinates: 362791..363042
- length: 252
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTTGGATTTATTGGAATGTTAATTGTCGGTGGCTTAATTGGATGGGCTGCTGGTGCT
ATTATGGGTAAAGATATCCCAGGTGGTATTTTAGGTAATATTATCGCAGGTATTATTGGA
TCATGGTTAGGTGGAACGTTATTAGGGCAATGGGGTCCTGAAATAGGAAGAATTTATATC
TTACCAGCATTAATTGGTTCAATTATCTTAATTGCAATCGTAACGTTAATTTTAAGAGCT
ATGCGTAAATAA60
120
180
240
252
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000328
- symbol: JSNZ_000328
- description: GlsB/YeaQ/YmgE family stress response membrane protein
- length: 83
- theoretical pI: 10.8709
- theoretical MW: 8555.5
- GRAVY: 1.29157
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking proteobacterial sortase system peptidoglycan-associated protein (TIGR03789; HMM-score: 6.7)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined Transgly_assoc; Transglycosylase associated protein (PF04226; HMM-score: 45.3)and 1 moreGlycine-zipper (CL0500) Gly-zipper_Omp; Glycine zipper (PF13488; HMM-score: 9.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9829
- Cell wall & surface Score: 0
- Extracellular Score: 0.0169
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.071555
- TAT(Tat/SPI): 0.002724
- LIPO(Sec/SPII): 0.112544
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWLGGTLLGQWGPEIGRIYILPALIGSIILIAIVTLILRAMRK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
SigB (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; regulation predicted or transferred from N315 and NCTC 8325 in Wolfgramm et al. (https://doi.org/10.1101/2025.09.03.674026) other strains
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]