Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0366 [new locus tag: NWMN_RS02070 ]
- pan locus tag?: SAUPAN001973000
- symbol: NWMN_0366
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0366 [new locus tag: NWMN_RS02070 ]
- symbol: NWMN_0366
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 414434..414685
- length: 252
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330200 NCBI
- RefSeq: YP_001331400 NCBI
- BioCyc:
- MicrobesOnline: 3705897 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTTGGATTTATTGGAATGTTAATTGTCGGTGGCTTAATTGGATGGGCTGCTGGTGCT
ATTATGGGTAAAGATATCCCAGGTGGTATTTTAGGCAATATTATCGCAGGTATTATTGGA
TCATGGGTAGGTGGCAAACTATTCGGACAATGGGGTCCTGAATTAGGAAGTATTTACATC
TTGCCAGCATTAATTGGTTCAATTATCTTAATTGCAATCGTAACGTTAATTTTAAGAGCT
ATGCGTAAATAA60
120
180
240
252
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0366 [new locus tag: NWMN_RS02070 ]
- symbol: NWMN_0366
- description: hypothetical protein
- length: 83
- theoretical pI: 10.6301
- theoretical MW: 8533.45
- GRAVY: 1.28193
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking proteobacterial sortase system peptidoglycan-associated protein (TIGR03789; HMM-score: 8.5)
- TheSEED :
- UPF0410 protein
- PFAM: no clan defined Transgly_assoc; Transglycosylase associated protein (PF04226; HMM-score: 48.8)and 2 moreCNNM; Cyclin M transmembrane N-terminal domain (PF01595; HMM-score: 12.9)Glycine-zipper (CL0500) Gly-zipper_Omp; Glycine zipper (PF13488; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9704
- Cell wall & surface Score: 0
- Extracellular Score: 0.0294
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.105843
- TAT(Tat/SPI): 0.003344
- LIPO(Sec/SPII): 0.138692
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGGKLFGQWGPELGSIYILPALIGSIILIAIVTLILRAMRK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)