From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0366 [new locus tag: NWMN_RS02070 ]
  • pan locus tag?: SAUPAN001973000
  • symbol: NWMN_0366
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0366 [new locus tag: NWMN_RS02070 ]
  • symbol: NWMN_0366
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 414434..414685
  • length: 252
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTTTGGATTTATTGGAATGTTAATTGTCGGTGGCTTAATTGGATGGGCTGCTGGTGCT
    ATTATGGGTAAAGATATCCCAGGTGGTATTTTAGGCAATATTATCGCAGGTATTATTGGA
    TCATGGGTAGGTGGCAAACTATTCGGACAATGGGGTCCTGAATTAGGAAGTATTTACATC
    TTGCCAGCATTAATTGGTTCAATTATCTTAATTGCAATCGTAACGTTAATTTTAAGAGCT
    ATGCGTAAATAA
    60
    120
    180
    240
    252


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_0366 [new locus tag: NWMN_RS02070 ]
  • symbol: NWMN_0366
  • description: hypothetical protein
  • length: 83
  • theoretical pI: 10.6301
  • theoretical MW: 8533.45
  • GRAVY: 1.28193

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking proteobacterial sortase system peptidoglycan-associated protein (TIGR03789; HMM-score: 8.5)
  • TheSEED  :
    • UPF0410 protein
  • PFAM:
    no clan defined Transgly_assoc; Transglycosylase associated protein (PF04226; HMM-score: 48.8)
    and 2 more
    CNNM; Cyclin M transmembrane N-terminal domain (PF01595; HMM-score: 12.9)
    Glycine-zipper (CL0500) Gly-zipper_Omp; Glycine zipper (PF13488; HMM-score: 11.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0002
    • Cytoplasmic Membrane Score: 0.9704
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0294
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.105843
    • TAT(Tat/SPI): 0.003344
    • LIPO(Sec/SPII): 0.138692
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGGKLFGQWGPELGSIYILPALIGSIILIAIVTLILRAMRK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1]   other strains

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]