From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS11010 [old locus tag: EGJ38_002206 ]
  • pan locus tag?: SAUPAN005694000
  • symbol: rpmC
  • pan gene symbol?: rpmC
  • synonym:
  • product: 50S ribosomal protein L29

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS11010 [old locus tag: EGJ38_002206 ]
  • symbol: rpmC
  • product: 50S ribosomal protein L29
  • replicon: chromosome
  • strand: -
  • coordinates: 2211232..2211441
  • length: 210
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (2211232..2211441) NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAAGCTAAGGAAATTAGAGACTTAACCACTTCAGAAATCGAAGAACAAATCAAATCT
    TCAAAAGAAGAGCTTTTTAACCTACGCTTTCAGTTAGCTACAGGTCAATTAGAAGAAACT
    GCACGTATTCGTACAGTAAGAAAAACGATTGCACGTCTAAAAACTGTTGCTCGTGAAAGA
    GAAATTGAACAAAGTAAGGCTAATCAATAA
    60
    120
    180
    210


⊟Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

⊟General[edit | edit source]

  • locus tag: EGJ38_RS11010 [old locus tag: EGJ38_002206 ]
  • symbol: RpmC
  • description: 50S ribosomal protein L29
  • length: 69
  • theoretical pI: 10.3881
  • theoretical MW: 8090.19
  • GRAVY: -0.895652

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL29 (TIGR00012; HMM-score: 76.9)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 87)
    and 2 more
    no clan defined MPH2; Maintenance of Photosystem II under High light 2 (PF20675; HMM-score: 14.1)
    HTH (CL0123) RIOX1_C_WH; Ribosomal oxygenase 1, C-terminal winged helix domain (PF21233; HMM-score: 13.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9689
    • Cytoplasmic Membrane Score: 0.0016
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0293
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004751
    • TAT(Tat/SPI): 0.024387
    • LIPO(Sec/SPII): 0.000866
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000644737 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTVAREREIEQSKANQ

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]