From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS10835 [old locus tag: EGJ38_002171 ]
  • pan locus tag?: SAUPAN005608000
  • symbol: EGJ38_RS10835
  • pan gene symbol?: —
  • synonym:
  • product: MerR family transcriptional regulator

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS10835 [old locus tag: EGJ38_002171 ]
  • symbol: EGJ38_RS10835
  • product: MerR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2187557..2187973
  • length: 417
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (2187557..2187973) NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAACTAAAGAAGTCGTAGCGCTCATGAATATATCTCAAGACACTTTAAGATATTAT
    GAAAAGGTTGGTGTGATTCCACCCGTTAATCGAGATGAAAATGGATATAGAATATATAAT
    GATAGTGATTTAAATTGGATTTATTTAGTGAAAAATTTGCGAAATGCAGGCGTCAGTATT
    GAATCGCTTATCGAATTTTGTAGATTAGCGCAGCTTCCTAAAAATAAAAATATTCAAACA
    CAGCAAAAGCAAATTTTAAATAAGCAACTCGAAGAATTAAATGAAAACTTAAAGACAATT
    CATGATGCGAGAGATTTACTAAAATATAAAATTGATAATTATGATAATCATATTGCTAAA
    ATCAATGCTAGTGATAATCATGATGACAATGTTGAACGTCTTTGGGAGAGAAAGTAA
    60
    120
    180
    240
    300
    360
    417


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_RS10835 [old locus tag: EGJ38_002171 ]
  • symbol: EGJ38_RS10835
  • description: MerR family transcriptional regulator
  • length: 138
  • theoretical pI: 7.59288
  • theoretical MW: 16343.4
  • GRAVY: -0.818841

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 63)
    Signal transduction Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 58.5)
    and 5 more
    Signal transduction Regulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 44.5)
    Cellular processes Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43)
    Signal transduction Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43)
    Cellular processes Cellular processes Detoxification mercuric resistence transcriptional repressor protein MerD (TIGR02054; HMM-score: 28.8)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 61.6)
    MerR; MerR family regulatory protein (PF00376; HMM-score: 51.7)
    and 12 more
    MerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 16)
    GME (CL0197) PAD; Protein-arginine deiminase (PAD) (PF03068; HMM-score: 14.5)
    no clan defined DUF6397; Family of unknown function (DUF6397) (PF19934; HMM-score: 14.3)
    HTH (CL0123) Rep3_C; Initiator Rep protein, WH2 (PF21205; HMM-score: 14.3)
    Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 14.2)
    Peptidase_CA (CL0125) Phytochelatin; Phytochelatin synthase (PF05023; HMM-score: 14)
    HTH (CL0123) HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14)
    ATP-grasp (CL0179) DNA_ligase_aden; NAD-dependent DNA ligase adenylation domain (PF01653; HMM-score: 13.8)
    GT-B (CL0113) RickCE_N; RickCE N-terminal (PF22189; HMM-score: 13.1)
    no clan defined DUF5320; Family of unknown function (DUF5320) (PF17253; HMM-score: 12.9)
    Tail_Terminator (CL0691) Phage_tail_terminator_7; Bacteriophage Tail Tube Terminator Protein (PF23818; HMM-score: 12.6)
    no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 10.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9496
    • Cytoplasmic Membrane Score: 0.0005
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0495
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014504
    • TAT(Tat/SPI): 0.000174
    • LIPO(Sec/SPII): 0.001416
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000850015 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSIESLIEFCRLAQLPKNKNIQTQQKQILNKQLEELNENLKTIHDARDLLKYKIDNYDNHIAKINASDNHDDNVERLWERK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]