From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS09835 [old locus tag: EGJ38_001970 ]
  • pan locus tag?: SAUPAN005001000
  • symbol: EGJ38_RS09835
  • pan gene symbol?:
  • synonym:
  • product: SE1626 family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS09835 [old locus tag: EGJ38_001970 ]
  • symbol: EGJ38_RS09835
  • product: SE1626 family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1982550..1982726
  • length: 177
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1982550..1982726) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    TTGAAACATCTAACAAAAATATTTGTAGTACTTGCAATTATTTTATTTATTATTGGTTAT
    TATTTACAAGCAACTAATCATGAAAGCCAAGGTATAAAATTATTATTAGCAGCGATTATG
    TTTATGATTTGTGCTTTTATAAGTAGAAGTAATGATCGACGTAAAAATAGTAAATAG
    60
    120
    177

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS09835 [old locus tag: EGJ38_001970 ]
  • symbol: EGJ38_RS09835
  • description: SE1626 family protein
  • length: 58
  • theoretical pI: 10.7419
  • theoretical MW: 6685.08
  • GRAVY: 0.551724

Function[edit | edit source]

  • TIGRFAM:
    Hypothetical proteins Conserved TIGR00245 family protein (TIGR00245; HMM-score: 18.3)
    and 1 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides oligosaccharide repeat unit polymerase (TIGR04370; HMM-score: 13.4)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 22.5)
    and 17 more
    ABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 17.4)
    CopD_like (CL0430) DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 16.8)
    no clan defined YesK; YesK-like protein (PF14150; HMM-score: 16.5)
    TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 15.7)
    Hypoth_1 (CL0447) DUF3784; Domain of unknown function (DUF3784) (PF12650; HMM-score: 15.5)
    Acyl_transf_3 (CL0316) Acyl_transf_3; Acyltransferase domain (PF01757; HMM-score: 15.1)
    no clan defined DUF7649; Domain of unknown function (DUF7649) (PF24661; HMM-score: 15.1)
    DUF131; Protein of unknown function DUF131 (PF01998; HMM-score: 14)
    RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 13.8)
    Cyt_c_ox_IV; Cytochrome c oxidase subunit IV (PF12270; HMM-score: 13.8)
    MFS (CL0015) MFS_1; Major Facilitator Superfamily (PF07690; HMM-score: 13.3)
    no clan defined FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 12.4)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 12.3)
    ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 11.9)
    NVEALA; NVEALA protein (PF14055; HMM-score: 10.8)
    DUF6903; Family of unknown function (DUF6903) (PF21844; HMM-score: 8.8)
    SPC12; Microsomal signal peptidase 12 kDa subunit (SPC12) (PF06645; HMM-score: 8.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9781
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0218
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.082012
    • TAT(Tat/SPI): 0.001183
    • LIPO(Sec/SPII): 0.06066
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000681968 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKHLTKIFVVLAIILFIIGYYLQATNHESQGIKLLLAAIMFMICAFISRSNDRRKNSK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]