Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS09835 [old locus tag: EGJ38_001970 ]
- pan locus tag?: SAUPAN005001000
- symbol: EGJ38_RS09835
- pan gene symbol?: —
- synonym:
- product: SE1626 family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS09835 [old locus tag: EGJ38_001970 ]
- symbol: EGJ38_RS09835
- product: SE1626 family protein
- replicon: chromosome
- strand: -
- coordinates: 1982550..1982726
- length: 177
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1982550..1982726) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121TTGAAACATCTAACAAAAATATTTGTAGTACTTGCAATTATTTTATTTATTATTGGTTAT
TATTTACAAGCAACTAATCATGAAAGCCAAGGTATAAAATTATTATTAGCAGCGATTATG
TTTATGATTTGTGCTTTTATAAGTAGAAGTAATGATCGACGTAAAAATAGTAAATAG60
120
177
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS09835 [old locus tag: EGJ38_001970 ]
- symbol: EGJ38_RS09835
- description: SE1626 family protein
- length: 58
- theoretical pI: 10.7419
- theoretical MW: 6685.08
- GRAVY: 0.551724
⊟Function[edit | edit source]
- TIGRFAM: Hypothetical proteins Conserved TIGR00245 family protein (TIGR00245; HMM-score: 18.3)and 1 moreCell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides oligosaccharide repeat unit polymerase (TIGR04370; HMM-score: 13.4)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 22.5)and 17 moreABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 17.4)CopD_like (CL0430) DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 16.8)no clan defined YesK; YesK-like protein (PF14150; HMM-score: 16.5)TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 15.7)Hypoth_1 (CL0447) DUF3784; Domain of unknown function (DUF3784) (PF12650; HMM-score: 15.5)Acyl_transf_3 (CL0316) Acyl_transf_3; Acyltransferase domain (PF01757; HMM-score: 15.1)no clan defined DUF7649; Domain of unknown function (DUF7649) (PF24661; HMM-score: 15.1)DUF131; Protein of unknown function DUF131 (PF01998; HMM-score: 14)RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 13.8)Cyt_c_ox_IV; Cytochrome c oxidase subunit IV (PF12270; HMM-score: 13.8)MFS (CL0015) MFS_1; Major Facilitator Superfamily (PF07690; HMM-score: 13.3)no clan defined FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 12.4)DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 12.3)ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 11.9)NVEALA; NVEALA protein (PF14055; HMM-score: 10.8)DUF6903; Family of unknown function (DUF6903) (PF21844; HMM-score: 8.8)SPC12; Microsomal signal peptidase 12 kDa subunit (SPC12) (PF06645; HMM-score: 8.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9781
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0218
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.082012
- TAT(Tat/SPI): 0.001183
- LIPO(Sec/SPII): 0.06066
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000681968 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKHLTKIFVVLAIILFIIGYYLQATNHESQGIKLLLAAIMFMICAFISRSNDRRKNSK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]