Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS05890 [old locus tag: EGJ38_001179 ]
- pan locus tag?: SAUPAN003492000
- symbol: rpoZ
- pan gene symbol?: rpoZ
- synonym:
- product: DNA-directed RNA polymerase subunit omega
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS05890 [old locus tag: EGJ38_001179 ]
- symbol: rpoZ
- product: DNA-directed RNA polymerase subunit omega
- replicon: chromosome
- strand: +
- coordinates: 1181506..1181724
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1181506..1181724) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTAAATCCACCATTAAACCAATTAACGTCACAAATTAAATCAAAGTATTTAATTGCA
ACAACTGCAGCGAAAAGAGCGCGTGAAATTGATGAACAACCTGAAACTGAATTATTAAGT
GAATATCATTCATTTAAACCAGTTGGTAGAGCGTTAGAAGAAATTGCTGACGGTAAAATT
CGCCCTGTTATTTCAAGTGATTATTATGGTAAAGAATAG60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS05890 [old locus tag: EGJ38_001179 ]
- symbol: RpoZ
- description: DNA-directed RNA polymerase subunit omega
- length: 72
- theoretical pI: 5.84158
- theoretical MW: 8150.19
- GRAVY: -0.626389
⊟Function[edit | edit source]
- reaction: EC 2.7.7.6? ExPASyDNA-directed RNA polymerase Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1)
- TIGRFAM: Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase, omega subunit (TIGR00690; EC 2.7.7.6; HMM-score: 46.5)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined RNA_pol_Rpb6; RNA polymerase Rpb6 (PF01192; HMM-score: 59)and 1 moreHAMP (CL0681) HAMP_2; HAMP domain (PF18947; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8994
- Cytoplasmic Membrane Score: 0.039
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0614
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.01031
- TAT(Tat/SPI): 0.001037
- LIPO(Sec/SPII): 0.002295
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000933956 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLNPPLNQLTSQIKSKYLIATTAAKRAREIDEQPETELLSEYHSFKPVGRALEEIADGKIRPVISSDYYGKE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]