Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002154 [new locus tag: EGJ38_RS10750 ]
- pan locus tag?: SAUPAN005580000
- symbol: amaP
- pan gene symbol?: amaP
- synonym: JSNZ_002154
- product: alkaline shock response membrane anchor protein AmaP
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002154 [new locus tag: EGJ38_RS10750 ]
- symbol: amaP
- product: alkaline shock response membrane anchor protein AmaP
- replicon: chromosome
- strand: -
- coordinates: 2171204..2171740
- length: 537
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424044 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481GTGAAACGACTTAAAAACTTTATCCTTGGCTTATTAATAGTAGTAATCGTGGGGTTCCTG
TTATTCATGTATATCCAAGATGGACGTATAACTGAATATCAAGACTACTTCCTTCAATTT
GAATGGTTCCAACCATTACTTATTTCACTTGCTGCACTATTGATATTAATAGGTCTTATA
TTAGTATTTAGTATCTTCAAACCTACGCATCGAAAACCTGGATTATACAAAGACTTCGAT
GATGGTCATGTTTACGTATCTCGTAAAGCTGTTGAAAAGACGGCATTCGATACGGTTGCA
AAATATGATCAAGTAAGACAACCAAATGTAGTTGCGAAACTATATAACAAAAAAAATAAA
TCTTATATCGACATTAAAACTGACTTTTTCGTACCAAATAATGTTCAAGTTCAATCTTTA
ACTGAAGCAATTCGTTCTGATATTAAAAAGAATGTAGAATATTTCACAGAAATGCCAGTA
CGTAAGTTAGAAGTTAATGTGAGAGATCAGAAAACTTCTGGTCCACGAGTGTTGTAA60
120
180
240
300
360
420
480
537
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002154 [new locus tag: EGJ38_RS10750 ]
- symbol: AmaP
- description: alkaline shock response membrane anchor protein AmaP
- length: 178
- theoretical pI: 10.0687
- theoretical MW: 20800.3
- GRAVY:
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined Asp23; Asp23 family, cell envelope-related function (PF03780; HMM-score: 19.8)and 7 moreDUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 15.4)DUF3098; Protein of unknown function (DUF3098) (PF11297; HMM-score: 14.4)LysE (CL0292) SfLAP; Sap, sulfolipid-1-addressing protein (PF11139; HMM-score: 14.1)BPD_transp_1 (CL0404) FtsX; FtsX-like permease C-terminal (PF02687; HMM-score: 11.8)no clan defined DUF997; Protein of unknown function (DUF997) (PF06196; HMM-score: 10.5)FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 10.1)FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 8.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9921
- Cell wall & surface Score: 0
- Extracellular Score: 0.0078
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007807
- TAT(Tat/SPI): 0.000163
- LIPO(Sec/SPII): 0.045242
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424044 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLILIGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYNKKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPRVL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : asp23 < EGJ38_002153 < amaP
⊟Regulation[edit | edit source]
- regulator: SigB/JSNZ_002025 (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Marret Müller, Swantje Reiß, Rabea Schlüter, Ulrike Mäder, Anica Beyer, Wenke Reiß, Jon Marles-Wright, Richard J Lewis, Henrike Pförtner, Uwe Völker, Katharina Riedel, Michael Hecker, Susanne Engelmann, Jan Pané-Farré
Deletion of membrane-associated Asp23 leads to upregulation of cell wall stress genes in Staphylococcus aureus.
Mol Microbiol: 2014, 93(6);1259-68
[PubMed:25074408] [WorldCat.org] [DOI] (I p)