Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001532 [new locus tag: EGJ38_RS07650 ]
- pan locus tag?: SAUPAN004120000
- symbol: comGD
- pan gene symbol?: comGD
- synonym:
- alternate name: JSNZ_001532
- product: competence type IV pilus minor pilin ComGD
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001532 [new locus tag: EGJ38_RS07650 ]
- symbol: comGD
- product: competence type IV pilus minor pilin ComGD
- replicon: chromosome
- strand: -
- coordinates: 1571339..1571785
- length: 447
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423489 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGAGAAGCAGTTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTG
GTAATGATGTTAATCAGTATATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAAT
CTTAGAGTAATAGATGATGAGGCAAATATCATTTCTTTTATTACTGAATTGAATTATATT
AAGTCGCAAGCTATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGAC
ACTATTAAAGTAATAGAGAATAATAAAATACGATTTCTAAAATTAAAAGTAGGCAAAATA
ATTAATGTTGCAAAAGTTGATATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTT
GGTAGCATAACAATTGACAATAACAATTCAATTTATAGAATAATATTCCATATTGAAAAA
GGAAGAATTCGTTATGAAAAGCTATAA60
120
180
240
300
360
420
447
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001532 [new locus tag: EGJ38_RS07650 ]
- symbol: ComGD
- description: competence type IV pilus minor pilin ComGD
- length: 148
- theoretical pI: 10.333
- theoretical MW: 17165.2
- GRAVY: 0.0797297
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 29.1)Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)and 5 moreCellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 19.4)Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 19.4)Cell envelope Surface structures type IV pilus modification protein PilV (TIGR02523; HMM-score: 13.2)Protein fate Protein modification and repair type IV pilus modification protein PilV (TIGR02523; HMM-score: 13.2)Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 11.5)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 28.1)and 2 moreCoV_RPol_N; Coronavirus RNA-dependent RNA polymerase, N-terminal (PF06478; HMM-score: 14.8)Plasmid_toxin (CL0136) HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9782
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0218
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.275053
- TAT(Tat/SPI): 0.006525
- LIPO(Sec/SPII): 0.036629
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423489 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSDTIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIDNNNSIYRIIFHIEKGRIRYEKL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Kazuya Morikawa, Yumiko Inose, Hideyuki Okamura, Atsushi Maruyama, Hideo Hayashi, Kunio Takeyasu, Toshiko Ohta
A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes.
Genes Cells: 2003, 8(8);699-712
[PubMed:12875655] [WorldCat.org] [DOI] (P p)