From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000585 [new locus tag: EGJ38_RS02920 ]
  • pan locus tag?: SAUPAN002485000
  • symbol: sarA
  • pan gene symbol?: sarA
  • synonym: JSNZ_000585
  • product: global transcriptional regulator SarA

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000585 [new locus tag: EGJ38_RS02920 ]
  • symbol: sarA
  • product: global transcriptional regulator SarA
  • replicon: chromosome
  • strand: -
  • coordinates: 620472..620846
  • length: 375
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422563 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGCAATTACAAAAATCAATGATTGCTTTGAGTTGTTATCAATGGTCACTTATGCTGAC
    AAATTAAAAAGTTTAATTAAAAAGGAATTTTCAATTAGCTTTGAAGAATTCGCTGTATTG
    ACATACATCAGCGAAAACAAAGAGAAAGAATACTATCTTAAAGATATTATTAATCATTTA
    AACTACAAACAACCACAAGTTGTTAAAGCAGTTAAAATTTTATCTCAAGAAGATTACTTC
    GATAAAAAACGTAATGAGCATGATGAAAGAACTGTATTAATTCTTGTTAATGCACAACAA
    CGTAAAAAAATCGAATCATTATTGAGTCGAGTAAATAAACGAATCACTGAAGCAAACAAC
    GAAATTGAACTATAA
    60
    120
    180
    240
    300
    360
    375

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000585 [new locus tag: EGJ38_RS02920 ]
  • symbol: SarA
  • description: global transcriptional regulator SarA
  • length: 124
  • theoretical pI: 8.4094
  • theoretical MW: 14717.9
  • GRAVY: -0.495968

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 118)
    and 6 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)
    Metabolism Central intermediary metabolism Amino sugars UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 13)
    undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 12.2)
    Genetic information processing Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 11.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 87.2)
    and 4 more
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 25)
    MarR_2; MarR family (PF12802; HMM-score: 22.4)
    MarR; MarR family (PF01047; HMM-score: 19.9)
    P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9019
    • Cytoplasmic Membrane Score: 0.0091
    • Cell wall & surface Score: 0.0007
    • Extracellular Score: 0.0884
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004617
    • TAT(Tat/SPI): 0.000227
    • LIPO(Sec/SPII): 0.000605
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422563 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB/JSNZ_002025 (activation) regulon
    SigB/JSNZ_002025(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [3] [4] [5]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Kristen M Sterba, Samuel G Mackintosh, Jon S Blevins, Barry K Hurlburt, Mark S Smeltzer
    Characterization of Staphylococcus aureus SarA binding sites.
    J Bacteriol: 2003, 185(15);4410-7
    [PubMed:12867449] [WorldCat.org] [DOI] (P p)
  2. Yingfang Liu, Adhar C Manna, Cheol-Ho Pan, Irina A Kriksunov, Daniel J Thiel, Ambrose L Cheung, Gongyi Zhang
    Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
    Proc Natl Acad Sci U S A: 2006, 103(7);2392-7
    [PubMed:16455801] [WorldCat.org] [DOI] (P p)
  3. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  4. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  5. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]